• Gene id: 51305

Gene Summary

• Gene Symbol: KCNK9   Gene   UCSC   Ensembl
• Aliases: K2p9.1, KT3.2, TASK-3, TASK3
• Gene name: potassium two pore domain channel subfamily K member 9
• Alternate names: potassium channel subfamily K member 9, TWIK-related acid-sensitive K(+) channel 3, acid-sensitive potassium channel protein TASK-3, potassium channel, two pore domain subfamily K, member 9, two pore K(+) channel KT3.2, two pore potassium channel KT3.2,
• Gene location: 8q24.3 (139703134: 139600837)     Exons: 5     NC_000008.11
• Gene summary(Entrez): This gene encodes a protein that contains multiple transmembrane regions and two pore-forming P domains and functions as a pH-dependent potassium channel. Amplification and overexpression of this gene have been observed in several types of human carcinoma
• OMIM: 605874

Protein Summary

• Protein general information: Q9NPC2  
  • Name: Potassium channel subfamily K member 9 (Acid sensitive potassium channel protein TASK 3) (TWIK related acid sensitive K(+) channel 3) (Two pore potassium channel KT3.2) (Two pore K(+) channel KT3.2)
  • Length: 374  
  • Mass: 42,264
• Sequence:

  MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAG
  VQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMR
  NTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSF
  MYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT
  CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV

• Structural information:
  • Interpro: IPR003280  IPR003092  IPR013099  IPR005407  
  • PDB: 3P1N 3P1O 3P1P 3P1Q 3P1R 3P1S 3SMK 3SML 3SMM 3SMN 3SMO 3SP5 3SPR 3UX0 4FR3
  • PDBsum: 3P1N 3P1O 3P1P 3P1Q 3P1R 3P1S 3SMK 3SML 3SMM 3SMN 3SMO 3SP5 3SPR 3UX0 4FR3
  • STRING: ENSP00000302166
• Other Databases: GeneCards:  KCNK9  Malacards:  KCNK9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006813	potassium ion transport	NAS	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006810	transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0006813	potassium ion transport	NAS	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0071804	cellular potassium ion transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006813	potassium ion transport	NAS	biological process
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0071805	potassium ion transmembrane transport	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04925	Aldosterone synthesis and secretion

Diseases

Associated diseases	References
Azoospermia	MIK: 25762640
Globozoospermia	MIK: 25762640
Male factor infertility	MIK: 25762640
Birk-Barel mental retardation syndrome	KEGG: H00709, PMID: 605874
Azoospermia, Globozoospermia	MIK: 25762640
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25762640	Azoospermia, Globozoospermia				Male infertility	GDAP1L1 GNAS KCNK9 LIN28B RB1 RTL1 SLC22A18 ZDBF2
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq