• Gene id: 51292

Gene Summary

• Gene Symbol: GMPR2   Gene   UCSC   Ensembl
• Aliases: GMPR 2
• Gene name: guanosine monophosphate reductase 2
• Alternate names: GMP reductase 2, guanosine 5'-monophosphate oxidoreductase 2, guanosine monophosphate reductase isolog,
• Gene location: 14q12 (24232621: 24239241)     Exons: 12     NC_000014.9
• Gene summary(Entrez): This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine
• OMIM: 610781

Protein Summary

• Protein general information: Q9P2T1  
  • Name: GMP reductase 2 (GMPR 2) (EC 1.7.1.7) (Guanosine 5' monophosphate oxidoreductase 2) (Guanosine monophosphate reductase 2)
  • Length: 348  
  • Mass: 37874
  • Tissue specificity: Highly expressed in heart, skeletal muscle, kidney, brain, liver, prostate, spleen, placenta, testis and ovary. Low expression in colon, thymus and peripheral blood leukocytes. {ECO
• Sequence:

  MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTA
  VHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFP
  QHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCP
  GDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGD
  VEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC

• Structural information:
  • Interpro: IPR013785  IPR005993  IPR015875  IPR001093  
  • Prosite: PS00487
  • CDD: cd00381
  • PDB: 2A7R 2BZN 2C6Q
  • PDBsum: 2A7R 2BZN 2C6Q
  • STRING: ENSP00000454038
• Other Databases: GeneCards:  GMPR2  Malacards:  GMPR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0015951	purine ribonucleotide interconversion	IBA	biological process
GO:0003920	GMP reductase activity	IBA	molecular function
GO:0046037	GMP metabolic process	IDA	biological process
GO:0003920	GMP reductase activity	IDA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0003920	GMP reductase activity	IEA	molecular function
GO:0009117	nucleotide metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:1902560	GMP reductase complex	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006144	purine nucleobase metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0003920	GMP reductase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0043101	purine-containing compound salvage	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006163	purine nucleotide metabolic process	IEA	biological process
GO:0003920	GMP reductase activity	IEA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)