• Gene id: 51268

Gene Summary

• Gene Symbol: PIPOX   Gene   UCSC   Ensembl
• Aliases: LPIPOX
• Gene name: pipecolic acid and sarcosine oxidase
• Alternate names: peroxisomal sarcosine oxidase, L-pipecolate oxidase, L-pipecolic acid oxidase, PSO, pipecolic acid oxidase,
• Gene location: 17q11.2 (29043140: 29057226)     Exons: 9     NC_000017.11
• OMIM: 148180

Protein Summary

• Protein general information: Q9P0Z9  
  • Name: Peroxisomal sarcosine oxidase (PSO) (EC 1.5.3.1) (EC 1.5.3.7) (L pipecolate oxidase) (L pipecolic acid oxidase)
  • Length: 390  
  • Mass: 44066
• Sequence:

  MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHECYQIW
  AQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVGLLDNSGGVIY
  AYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIEMPLQTLRIN
  VCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSS
  FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLA
  PFRISRFPSLGKAHL

• Structural information:
  • Interpro: IPR006076  IPR036188  IPR006281  
  • STRING: ENSP00000317721
• Other Databases: GeneCards:  PIPOX  Malacards:  PIPOX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005777	peroxisome	IBA	cellular component
GO:0008115	sarcosine oxidase activity	IBA	molecular function
GO:0033514	L-lysine catabolic process to acetyl-CoA via L-pipecolate	IBA	biological process
GO:0050031	L-pipecolate oxidase activity	IBA	molecular function
GO:0046653	tetrahydrofolate metabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0008115	sarcosine oxidase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0050031	L-pipecolate oxidase activity	IEA	molecular function
GO:0008115	sarcosine oxidase activity	IEA	molecular function
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006554	lysine catabolic process	TAS	biological process
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0050031	L-pipecolate oxidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0033514	L-lysine catabolic process to acetyl-CoA via L-pipecolate	IDA	biological process
GO:0008115	sarcosine oxidase activity	IDA	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0050031	L-pipecolate oxidase activity	IDA	molecular function
GO:0050031	L-pipecolate oxidase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04146	Peroxisome
hsa00310	Lysine degradation
hsa00260	Glycine, serine and threonine metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881