• Gene id: 51234

Gene Summary

• Gene Symbol: EMC4   Gene   UCSC   Ensembl
• Aliases: PIG17, TMEM85
• Gene name: ER membrane protein complex subunit 4
• Alternate names: ER membrane protein complex subunit 4, cell proliferation-inducing gene 17 protein, transmembrane protein 85,
• Gene location: 15q14 (34225015: 34230155)     Exons: 5     NC_000015.10
• OMIM: 616245

Protein Summary

• Protein general information: Q5J8M3  
  • Name: ER membrane protein complex subunit 4 (Cell proliferation inducing gene 17 protein) (Transmembrane protein 85)
  • Length: 183  
  • Mass: 20087
  • Tissue specificity: Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart. {ECO
• Sequence:

  MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALG
  PLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLMGLALAVYK
  CQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL

• Structural information:
  • Interpro: IPR009445  
  • STRING: ENSP00000267750
• Other Databases: GeneCards:  EMC4  Malacards:  EMC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072546	ER membrane protein complex	IBA	cellular component
GO:0072546	ER membrane protein complex	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881