• Gene id: 51205

Gene Summary

• Gene Symbol: ACP6   Gene   UCSC   Ensembl
• Aliases: ACPL1, LPAP, PACPL1
• Gene name: acid phosphatase 6, lysophosphatidic
• Alternate names: lysophosphatidic acid phosphatase type 6, acid phosphatase-like protein 1,
• Gene location: 1q21.2 (48993447: 49015994)     Exons: 16     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the histidine acid phosphatase protein family. The encoded protein hydrolyzes lysophosphatidic acid, which is involved in G protein-coupled receptor signaling, lipid raft modulation, and in balancing lipid composition within
• OMIM: 611471

Protein Summary

• Protein general information: Q9NPH0  
  • Name: Lysophosphatidic acid phosphatase type 6 (EC 3.1.3.2) (Acid phosphatase 6, lysophosphatidic) (Acid phosphatase like protein 1) (PACPL1)
  • Length: 428  
  • Mass: 48886
  • Tissue specificity: Highly expressed in kidney, heart, small intestine, muscle, liver, prostate, testis, ovary and weakly expressed in thymus and colon. {ECO
• Sequence:

  MITGVFSMRLWTPVGVLTSLAYCLHQRRVALAELQEADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVE
  WNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFL
  SPTFNPQEVFIRSTNIFRNLESTRCLLAGLFQCQKEGPIIIHTDEADSEVLYPNYQSCWSLRQRTRGRRQTASLQ
  PGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMA
  VGPFLHILESNLLKAMDSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDHKWPPFAVDLTMELYQHLESKEWFVQ
  LYYHGKEQVPRGCPDGLCPLDMFLNAMSVYTLSPEKYHALCSQTQVMEVGNEE

• Structural information:
  • Interpro: IPR033379  IPR000560  IPR029033  
  • Prosite: PS00616
  • CDD: cd07061
  • PDB: 4JOB 4JOC 4JOD
  • PDBsum: 4JOB 4JOC 4JOD
  • STRING: ENSP00000463574
• Other Databases: GeneCards:  ACP6  Malacards:  ACP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0052642	lysophosphatidic acid phosphatase activity	IDA	molecular function
GO:0052642	lysophosphatidic acid phosphatase activity	IDA	molecular function
GO:2001311	lysobisphosphatidic acid metabolic process	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0006644	phospholipid metabolic process	IMP	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0003993	acid phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0052642	lysophosphatidic acid phosphatase activity	TAS	molecular function
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881