• Gene id: 51166

Gene Summary

• Gene Symbol: AADAT   Gene   UCSC   Ensembl
• Aliases: KAT2, KATII, KYAT2
• Gene name: aminoadipate aminotransferase
• Alternate names: kynurenine/alpha-aminoadipate aminotransferase, mitochondrial, 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, KAT/AadAT, L kynurenine/alpha aminoadipate aminotransferase, alpha-aminoadipate aminotransferase, kynurenine aminotransferase II, kynuren,
• Gene location: 4q33 (170091698: 170060221)     Exons: 18     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccarop

Protein Summary

• Protein general information: Q8N5Z0  
  • Name: Kynurenine/alpha aminoadipate aminotransferase, mitochondrial (KAT/AadAT) (2 aminoadipate aminotransferase) (2 aminoadipate transaminase) (EC 2.6.1.39) (Alpha aminoadipate aminotransferase) (AadAT) (Kynurenine aminotransferase II) (Kynurenine oxoglutarat
  • Length: 425  
  • Mass: 47352
  • Tissue specificity: Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary.
• Sequence:

  MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYS
  PSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLH
  PLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDF
  LIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
  LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAV
  KMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

• Structural information:
  • Interpro: IPR004839  IPR015424  IPR015421  
  • PDB: 2QLR 2R2N 2VGZ 2XH1 3DC1 3UE8 4GDY 4GE4 4GE7 4GE9 4GEB 5EFS 5EUN 5TF5 6D0A
  • PDBsum: 2QLR 2R2N 2VGZ 2XH1 3DC1 3UE8 4GDY 4GE4 4GE7 4GE9 4GEB 5EFS 5EUN 5TF5 6D0A
  • STRING: ENSP00000423190
• Other Databases: GeneCards:  AADAT  Malacards:  AADAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901605	alpha-amino acid metabolic process	IBA	biological process
GO:0016212	kynurenine-oxoglutarate transaminase activity	IBA	molecular function
GO:0008483	transaminase activity	IBA	molecular function
GO:0047536	2-aminoadipate transaminase activity	IDA	molecular function
GO:0006103	2-oxoglutarate metabolic process	IDA	biological process
GO:0070189	kynurenine metabolic process	IDA	biological process
GO:0016212	kynurenine-oxoglutarate transaminase activity	IDA	molecular function
GO:0006536	glutamate metabolic process	IDA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0009058	biosynthetic process	IEA	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0008483	transaminase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0047536	2-aminoadipate transaminase activity	IEA	molecular function
GO:0016212	kynurenine-oxoglutarate transaminase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006554	lysine catabolic process	TAS	biological process
GO:0006569	tryptophan catabolic process	TAS	biological process
GO:0016212	kynurenine-oxoglutarate transaminase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0097052	L-kynurenine metabolic process	IEA	biological process
GO:0097052	L-kynurenine metabolic process	IEA	biological process
GO:0097052	L-kynurenine metabolic process	IEA	biological process
GO:0097052	L-kynurenine metabolic process	IEA	biological process
GO:0033512	L-lysine catabolic process to acetyl-CoA via saccharopine	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00310	Lysine degradation
hsa00380	Tryptophan metabolism
hsa01210	2-Oxocarboxylic acid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881