Search Result
| Gene id | 51155 | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | JPT1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | ARM2, HN1, HN1A | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | Jupiter microtubule associated homolog 1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | jupiter microtubule associated homolog 1, androgen-regulated protein 2, hematological and neurological expressed 1 protein, | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
17q25.1 (75154511: 75135242) Exons: 7 NC_000017.11 |
||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9UK76 Name: Jupiter microtubule associated homolog 1 (Androgen regulated protein 2) (Hematological and neurological expressed 1 protein) [Cleaved into: Jupiter microtubule associated homolog 1, N terminally processed] Length: 154 Mass: 16015 Tissue specificity: Expressed in testis, skeletal muscle, thymus, prostate, colon, peripheral blood cells, brain and placenta. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKSAGAKSSGGRE DLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSS LVLG | ||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: JPT1  Malacards: JPT1 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||