Search Result
| Gene id | 51131 | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | PHF11 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | APY, BCAP, IGEL, IGER, IGHER, NY-REN-34, NYREN34 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | PHD finger protein 11 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | PHD finger protein 11, BRCA1 C-terminus-associated protein, IgE responsiveness (atopic), renal carcinoma antigen NY-REN-34, | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
13q14.2 (49495952: 49528991) Exons: 13 NC_000013.11 |
||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein containing a PHD (plant homeodomain) type zinc finger. This gene has been identified in some studies as a candidate gene for asthma. Naturally-occurring readthrough transcription may occur from the upstream SETDB2 (SET domain b |
||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 607796 | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9UIL8 Name: PHD finger protein 11 (BRCA1 C terminus associated protein) (Renal carcinoma antigen NY REN 34) Length: 331 Mass: 37582 Tissue specificity: Highly expressed in T and B-cells, as well as natural killer and mature dendritic cells. Expressed at higher levels in Th1 as compared to Th2 cells. Expressed at low levels in all normal tissues tested, including lung, testis, small in | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MAQASPPRPERVLGASSPEARPAQEALLLPTGVFQVAEKMEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYS SGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRG IYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCK EAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEI ELLQDLKQTLCSFQENRDLMSSSTSISSLSY | ||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: PHF11  Malacards: PHF11 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||