• Gene id: 51115

Gene Summary

• Gene Symbol: RMDN1   Gene   UCSC   Ensembl
• Aliases: CGI-90, FAM82B, RMD-1, RMD1
• Gene name: regulator of microtubule dynamics 1
• Alternate names: regulator of microtubule dynamics protein 1, family with sequence similarity 82, member B, microtubule-associated protein,
• Gene location: 8q21.3 (86514356: 86467054)     Exons: 15     NC_000008.11
• OMIM: 611871

Protein Summary

• Protein general information: Q96DB5  
  • Name: Regulator of microtubule dynamics protein 1 (RMD 1) (hRMD 1) (Protein FAM82B)
  • Length: 314  
  • Mass: 35808
• Sequence:

  MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGTFKRGLLLSALSYLGFETYQVISQAA
  VVHATAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYA
  KRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHLMGIWCYTFAEMPWYQ
  RRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQIQ
  TEAAQLLTSFSEKN

• Structural information:
  • Interpro: IPR011990  
  • STRING: ENSP00000385927
• Other Databases: GeneCards:  RMDN1  Malacards:  RMDN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881