• Gene id: 51092

Gene Summary

• Gene Symbol: SIDT2   Gene   UCSC   Ensembl
• Aliases: CGI-40
• Gene name: SID1 transmembrane family member 2
• Alternate names: SID1 transmembrane family member 2,
• Gene location: 11q23.3 (117178742: 117197441)     Exons: 26     NC_000011.10
• OMIM: 617551

Protein Summary

• Protein general information: Q8NBJ9  
  • Name: SID1 transmembrane family member 2
  • Length: 832  
  • Mass: 94454
• Sequence:

  MFALGLPFLVLLVASVESHLGVLGPKNVSQKDAEFERTYVDEVNSELVNIYTFNHTVTRNRTEGVRVSVNVLNKQ
  KGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPTKNESEIQFFYVDVSTLSPVNTTYQLRVSR
  MDDFVLRTGEQFSFNTTAAQPQYFKYEFPEGVDSVIVKVTSNKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTM
  TKKAAITVQRKDFPSNSFYVVVVVKTEDQACGGSLPFYPFAEDEPVDQGHRQKTLSVLVSQAVTSEAYVSGMLFC
  LGIFLSFYLLTVLLACWENWRQKKKTLLVAIDRACPESGHPRVLADSFPGSSPYEGYNYGSFENVSGSTDGLVDS
  AGTGDLSYGYQGRSFEPVGTRPRVDSMSSVEEDDYDTLTDIDSDKNVIRTKQYLYVADLARKDKRVLRKKYQIYF
  WNIATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLCAHPLGNLSAFNNILSNLGYILLGLLFLLIILQREI
  NHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHP
  DINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKLDSGIFRRILHVLYTD
  CIRQCSGPLYVDRMVLLVMGNVINWSLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLL
  CIVCTSVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSFLVLLTLDDDLDTVQ
  RDKIYVF

• Structural information:
  • Interpro: IPR025958  
  • STRING: ENSP00000314023
• Other Databases: GeneCards:  SIDT2  Malacards:  SIDT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IBA	cellular component
GO:0003725	double-stranded RNA binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0050658	RNA transport	IBA	biological process
GO:0051033	RNA transmembrane transporter activity	IBA	molecular function
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0050658	RNA transport	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0051032	nucleic acid transmembrane transporter activity	ISS	molecular function
GO:0035612	AP-2 adaptor complex binding	ISS	molecular function
GO:0006401	RNA catabolic process	ISS	biological process
GO:0035650	AP-1 adaptor complex binding	ISS	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051033	RNA transmembrane transporter activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0051032	nucleic acid transmembrane transporter activity	IEA	molecular function
GO:0042593	glucose homeostasis	IEA	biological process
GO:0035612	AP-2 adaptor complex binding	IEA	molecular function
GO:0009749	response to glucose	IEA	biological process
GO:0006401	RNA catabolic process	IEA	biological process
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0000902	cell morphogenesis	IEA	biological process
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0050658	RNA transport	IEA	biological process
GO:0044342	type B pancreatic cell proliferation	IEA	biological process
GO:0035650	AP-1 adaptor complex binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0003323	type B pancreatic cell development	IEA	biological process
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq