• Gene id: 51050

Gene Summary

• Gene Symbol: PI15   Gene   UCSC   Ensembl
• Aliases: CRISP8, P24TI, P25TI
• Gene name: peptidase inhibitor 15
• Alternate names: peptidase inhibitor 15, 25 kDa trypsin inhibitor, CRISP-8, PI-15, cysteine-rich secretory protein 8, protease inhibitor 15, sugarCrisp,
• Gene location: 8q21.13 (74824533: 74855028)     Exons: 7     NC_000008.11
• Gene summary(Entrez): This gene encodes a trypsin inhibitor. The protein shares similarity to insect venom allergens, mammalian testis-specific proteins and plant pathogenesis-related proteins. It is frequently expressed in human neuroblastoma and glioblastoma cell lines, and
• OMIM: 607076

Protein Summary

• Protein general information: O43692  
  • Name: Peptidase inhibitor 15 (PI 15) (25 kDa trypsin inhibitor) (p25TI) (Cysteine rich secretory protein 8) (CRISP 8) (SugarCrisp)
  • Length: 258  
  • Mass: 29065
  • Tissue specificity: Weakly expressed. Expressed at low level in prostate, mammary gland, salivary gland and thyroid gland. {ECO
• Sequence:

  MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHN
  QVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYA
  FPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKV
  GVPCSSCPPSYGGSCTDNLCFPGVTSNYLYWFK

• Structural information:
  • Protein Domains: (71..21-)
    (/note="SCP"-)
  • Interpro: IPR018244  IPR014044  IPR035940  IPR001283  
  • Prosite: PS01010
  • STRING: ENSP00000260113
• Other Databases: GeneCards:  PI15  Malacards:  PI15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 21412036

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)