• Gene id: 51031

Gene Summary

• Gene Symbol: GLOD4   Gene   UCSC   Ensembl
• Aliases: C17orf25, CGI-150, HC71
• Gene name: glyoxalase domain containing 4
• Alternate names: glyoxalase domain-containing protein 4,
• Gene location: 17p13.3 (789829: 759308)     Exons: 12     NC_000017.11

Protein Summary

• Protein general information: Q9HC38  
  • Name: Glyoxalase domain containing protein 4
  • Length: 313  
  • Mass: 34793
  • Tissue specificity: Expressed in heart, brain, liver, kidney, pancreas and placenta. Not expressed in skeletal muscle and lung. {ECO
• Sequence:

  MAARRALHFVFKVGNRFQTARFYRDVLGMKVESCSVARLECSGAISAHCSDYTRITEDSFSKPYDGKWSKTMVGF
  GPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQS
  DPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKE
  LPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSD
  EWFAKHNKPKASG

• Structural information:
  • Protein Domains: (5..14-)
    (/note="VOC-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01163-)
    (152..27-)
    (/note="VOC-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01163"-)
  • Interpro: IPR029068  IPR037523  
  • Prosite: PS51819
  • PDB: 3ZI1
  • PDBsum: 3ZI1
• Other Databases: GeneCards:  GLOD4  Malacards:  GLOD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq