• Gene id: 51022

Gene Summary

• Gene Symbol: GLRX2   Gene   UCSC   Ensembl
• Aliases: CGI-133, GRX2
• Gene name: glutaredoxin 2
• Alternate names: glutaredoxin 2, bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2), glutaredoxin (thioltransferase) 2,
• Gene location: 1q31.2 (156054781: 156058505)     Exons: 4     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the glutaredoxin family of proteins, which maintain cellular thiol homeostasis. These proteins are thiol-disulfide oxidoreductases that use a glutathione-binding site and one or two active cysteines in their
• OMIM: 606820

Protein Summary

• Protein general information: Q9NS18  
  • Name: Glutaredoxin 2, mitochondrial
  • Length: 164  
  • Mass: 18052
  • Tissue specificity: Widely expressed. Expressed in brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta and lung. Not expressed in peripheral blood leukocytes. {ECO
• Sequence:

  MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKT
  SCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLV
  HQCYLKKSKRKEFQ

• Structural information:
  • Protein Domains: (57..15-)
    (/note="Glutaredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00686"-)
  • Interpro: IPR002109  IPR011899  IPR014025  IPR036249  
  • Prosite: PS51354
  • PDB: 2CQ9 2FLS 2HT9
  • PDBsum: 2CQ9 2FLS 2HT9
  • STRING: ENSP00000356410
• Other Databases: GeneCards:  GLRX2  Malacards:  GLRX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0009055	electron transfer activity	IEA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007568	aging	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0071451	cellular response to superoxide	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0022900	electron transport chain	IEA	biological process
GO:0022900	electron transport chain	IEA	biological process
GO:0042542	response to hydrogen peroxide	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0010033	response to organic substance	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0051775	response to redox state	TAS	biological process
GO:0042262	DNA protection	NAS	biological process
GO:0006749	glutathione metabolic process	TAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0003756	protein disulfide isomerase activity	TAS	molecular function
GO:0015038	glutathione disulfide oxidoreductase activity	TAS	molecular function
GO:0008794	arsenate reductase (glutaredoxin) activity	TAS	molecular function
GO:0008794	arsenate reductase (glutaredoxin) activity	TAS	molecular function
GO:0045454	cell redox homeostasis	TAS	biological process
GO:0042262	DNA protection	NAS	biological process
GO:0009966	regulation of signal transduction	NAS	biological process
GO:0009055	electron transfer activity	NAS	molecular function
GO:0006915	apoptotic process	NAS	biological process
GO:0003756	protein disulfide isomerase activity	TAS	molecular function
GO:0030154	cell differentiation	NAS	biological process
GO:0015038	glutathione disulfide oxidoreductase activity	TAS	molecular function
GO:0009266	response to temperature stimulus	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray