Search Result
| Gene id | 51018 | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||
| Gene Symbol | RRP15 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||
| Aliases | CGI-115, KIAA0507 | ||||||||||||||||||||||||||||||||
| Gene name | ribosomal RNA processing 15 homolog | ||||||||||||||||||||||||||||||||
| Alternate names | RRP15-like protein, ribosomal RNA-processing protein 15, | ||||||||||||||||||||||||||||||||
| Gene location |
1q41 (218285292: 218337982) Exons: 6 NC_000001.11 |
||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60S ribosomal particles, and is required for the early maturation steps of the 60S subunit. [provided by RefSeq, Jul 2008] |
||||||||||||||||||||||||||||||||
| OMIM | 611193 | ||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||
| Protein general information | Q9Y3B9 Name: RRP15 like protein (Ribosomal RNA processing protein 15) Length: 282 Mass: 31484 | ||||||||||||||||||||||||||||||||
| Sequence |
MAAAAPDSRVSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCD KENENDGESSVGTNMGWADAMAKVLNKKTPESKPTILVKNKKLEKEKEKLKQERLEKIKQRDKRLEWEMMCRVKP DVVQDKETERNLQRIATRGVVQLFNAVQKHQKNVDEKVKEAGSSMRKRAKLISTVSKKDFISVLRGMDGSTNETA SSRKKPKAKQTEVKSEEGPGWTILRDDFMMGASMKDWDKESDGPDDSRPESASDSDT | ||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: RRP15  Malacards: RRP15 | ||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||