• Gene id: 51000

Gene Summary

• Gene Symbol: SLC35B3   Gene   UCSC   Ensembl
• Aliases: C6orf196, CGI-19, PAPST2
• Gene name: solute carrier family 35 member B3
• Alternate names: adenosine 3'-phospho 5'-phosphosulfate transporter 2, 3' phosphoadenosine 5' phosphosulfate transporter 2, PAPS transporter 2, solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B3,
• Gene location: 6p24.3 (8435566: 8411434)     Exons: 14     NC_000006.12
• Gene summary(Entrez): This gene is a member of the solute carrier family. The encoded protein is involved in the transport of 3-prime phosphoadenosine 5-prime phosphosulfate (PAPS) from the nucleus or the cytosol to the Golgi lumen. This gene has been reported to be expressed
• OMIM: 610845

Protein Summary

• Protein general information: Q9H1N7  
  • Name: Adenosine 3' phospho 5' phosphosulfate transporter 2 (3' phosphoadenosine 5' phosphosulfate transporter) (PAPS transporter 2) (Solute carrier family 35 member B3)
  • Length: 401  
  • Mass: 44593
  • Tissue specificity: Preferentially and highly expressed in colon. {ECO
• Sequence:

  MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKF
  NKLTQFFICVAGVFVFYLIYGYLQELIFSVEGFKSCGWYLTLVQFAFYSIFGLIELQLIQDKRRRIPGKTYMIIA
  FLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQGKRYNVADVSAAICMSLGLIWFTLADSTTAPNFN
  LTGVVLISLALCADAVIGNVQEKAMKLHNASNSEMVLYSYSIGFVYILLGLTCTSGLGPAVTFCAKNPVRTYGYA
  FLFSLTGYFGISFVLALIKIFGALIAVTVTTGRKAMTIVLSFIFFAKPFTFQYVWSGLLVVLGIFLNVYSKNMDK
  IRLPSLYDLINKSVEARKSRTLAQTV

• Structural information:
  • Interpro: IPR013657  
  • STRING: ENSP00000368981
• Other Databases: GeneCards:  SLC35B3  Malacards:  SLC35B3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046964	3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activity	IBA	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050428	3'-phosphoadenosine 5'-phosphosulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:1902559	3'-phospho-5'-adenylyl sulfate transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881