• Gene id: 50863

Gene Summary

• Gene Symbol: NTM   Gene   UCSC   Ensembl
• Aliases: CEPU-1, HNT, IGLON2, NTRI
• Gene name: neurotrimin
• Alternate names: neurotrimin, IgLON family member 2,
• Gene location: 11q25 (131370307: 132336821)     Exons: 17     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the IgLON (LAMP, OBCAM, Ntm) family of immunoglobulin (Ig) domain-containing glycosylphosphatidylinositol (GPI)-anchored cell adhesion molecules. The encoded protein may promote neurite outgrowth and adhesion via a homophilic
• OMIM: 607938

Protein Summary

• Protein general information: Q9P121  
  • Name: Neurotrimin (hNT) (IgLON family member 2)
  • Length: 344  
  • Mass: 37971
• Sequence:

  MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTIL
  YAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEG
  NNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYI
  SEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNK
  LGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF

• Structural information:
  • Protein Domains: (39..12-)
    1 (/note="Ig-like-C2-type)
    (136..21-)
    2 (/note="Ig-like-C2-type)
    (222..30-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  IPR013151  
  • Prosite: PS50835
  • PDB: 6DLF
  • PDBsum: 6DLF
  • STRING: ENSP00000396722
• Other Databases: GeneCards:  NTM  Malacards:  NTM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	NAS	biological process
GO:0008038	neuron recognition	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray