• Gene id: 50835

Gene Summary

• Gene Symbol: TAS2R9   Gene   UCSC   Ensembl
• Aliases: T2R9, TRB6
• Gene name: taste 2 receptor member 9
• Alternate names: taste receptor type 2 member 9, taste receptor, family B, member 6, taste receptor, type 2, member 9,
• Gene location: 12p13.2 (10810167: 10809093)     Exons: 1     NC_000012.12
• Gene summary(Entrez): This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organiz
• OMIM: 604795

Protein Summary

• Protein general information: Q9NYW1  
  • Name: Taste receptor type 2 member 9 (T2R9) (Taste receptor family B member 6) (TRB6)
  • Length: 312  
  • Mass: 35611
  • Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
• Sequence:

  MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILISLAISRICLLCVISLDGFFMLLFPGT
  YGNSVLVSIVNVVWTFANNSSLWFTSCLSIFYLLKIANISHPFFFWLKLKINKVMLAILLGSFLISLIISVPKND
  DMWYHLFKVSHEENITWKFKVSKIPGTFKQLTLNLGVMVPFILCLISFFLLLFSLVRHTKQIRLHATGFRDPSTE
  AHMRAIKAVIIFLLLLIVYYPVFLVMTSSALIPQGKLVLMIGDIVTVIFPSSHSFILIMGNSKLREAFLKMLRFV
  KCFLRRRKPFVP

• Structural information:
  • Interpro: IPR017452  IPR007960  
  • Prosite: PS50262
  • STRING: ENSP00000240691
• Other Databases: GeneCards:  TAS2R9  Malacards:  TAS2R9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033038	bitter taste receptor activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IBA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050909	sensory perception of taste	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0008527	taste receptor activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)