• Gene id: 50804

Gene Summary

• Gene Symbol: MYEF2   Gene   UCSC   Ensembl
• Aliases: HsT18564, MEF-2, MST156, MSTP156, myEF-2
• Gene name: myelin expression factor 2
• Alternate names: myelin expression factor 2, myelin gene expression factor 2,
• Gene location: 15q21.1 (48178516: 48134631)     Exons: 19     NC_000015.10
• OMIM: 610774

Protein Summary

• Protein general information: Q9P2K5  
  • Name: Myelin expression factor 2 (MEF 2) (MyEF 2) (MST156)
  • Length: 600  
  • Mass: 64122
• Sequence:

  MADANKAEVPGATGGDSPHLQPAEPPGEPRREPHPAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSK
  KANRFHPYSKDKNSGAGEKKGPNRNRVFISNIPYDMKWQAIKDLMREKVGEVTYVELFKDAEGKSRGCGVVEFKD
  EEFVKKALETMNKYDLSGRPLNIKEDPDGENARRALQRTGGSFPGGHVPDMGSGLMNLPPSILNNPNIPPEVISN
  LQAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMGTVTFEQAIEAVQAISMFNGQFLFD
  RPMHVKMDDKSVPHEEYRSHDGKTPQLPRGLGGIGMGLGPGGQPISASQLNIGGVMGNLGPGGMGMDGPGFGGMN
  RIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIGGFAGRIGSS
  NMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQI
  FVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA

• Structural information:
  • Protein Domains: (100..17-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (233..31-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (523..59-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR034632  IPR034630  IPR034631  IPR012677  IPR035979   IPR000504  
  • Prosite: PS50102
  • CDD: cd12658 cd12662
  • STRING: ENSP00000316950
• Other Databases: GeneCards:  MYEF2  Malacards:  MYEF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0071014	post-mRNA release spliceosomal complex	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:2000815	regulation of mRNA stability involved in response to oxidative stress	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0030182	neuron differentiation	IEP	biological process
GO:0014902	myotube differentiation	IEP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881