• Gene id: 50626

Gene Summary

• Gene Symbol: CYHR1   Gene   UCSC   Ensembl
• Aliases: CHRP
• Gene name: cysteine and histidine rich 1
• Alternate names: cysteine and histidine-rich protein 1, cysteine and histidine rich protein, cysteine/histidine-rich 1,
• Gene location: 8q24.3 (144465700: 144449581)     Exons: 2     NC_000008.11
• OMIM: 616635

Protein Summary

• Protein general information: Q6ZMK1  
  • Name: Cysteine and histidine rich protein 1
  • Length: 362  
  • Mass: 40703
• Sequence:

  MAPKPGAEWSTALSHLVLGVVSLHAAVSTAEASRGAAAGFLLQVLAATTTLAPGLSTHEDCLAGAWVATVIGLPL
  LAFDFHWCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSL
  LERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLS
  FEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLLLKSKVTAPLECS
  FLLLKGPYDDVRISPVIYHFVFTNESNETDYVPLPIIDSVECNKLLAAKNINLRLFLFQIQK

• Structural information:
  • Interpro: IPR039338  IPR008974  IPR013083  IPR001293  
  • Prosite: PS50145
  • STRING: ENSP00000387426
• Other Databases: GeneCards:  CYHR1  Malacards:  CYHR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq