• Gene id: 50515

Gene Summary

• Gene Symbol: CHST11   Gene   UCSC   Ensembl
• Aliases: C4ST, C4ST-1, C4ST1, HSA269537, OCBMD
• Gene name: carbohydrate sulfotransferase 11
• Alternate names: carbohydrate sulfotransferase 11, C4S-1, IgH/CHST11 fusion, carbohydrate (chondroitin 4) sulfotransferase 11, chondroitin 4-O-sulfotransferase 1,
• Gene location: 12q23.3 (104456947: 104762013)     Exons: 7     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constit
• OMIM: 607646

Protein Summary

• Protein general information: Q9NPF2  
  • Name: Carbohydrate sulfotransferase 11 (EC 2.8.2.5) (Chondroitin 4 O sulfotransferase 1) (Chondroitin 4 sulfotransferase 1) (C4S 1) (C4ST 1) (C4ST1)
  • Length: 352  
  • Mass: 41555
  • Tissue specificity: Widely expressed. Highly expressed in spleen, thymus, bone marrow, peripheral blood leukocytes, lymph node, heart, brain, lung and placenta. {ECO
• Sequence:

  MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTA
  VLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTGRGKYSDPMEI
  PANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNISFHKRYGTKIIKRQRKNAT
  QEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLK
  FPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE

• Structural information:
  • Interpro: IPR018011  IPR005331  
  • STRING: ENSP00000305725
• Other Databases: GeneCards:  CHST11  Malacards:  CHST11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030166	proteoglycan biosynthetic process	IBA	biological process
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016051	carbohydrate biosynthetic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0047756	chondroitin 4-sulfotransferase activity	IEA	molecular function
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0050659	N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity	IEA	molecular function
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological process
GO:0048589	developmental growth	IEA	biological process
GO:0042733	embryonic digit morphogenesis	IEA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0030206	chondroitin sulfate biosynthetic process	IEA	biological process
GO:0007585	respiratory gaseous exchange by respiratory system	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0048703	embryonic viscerocranium morphogenesis	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0036342	post-anal tail morphogenesis	IEA	biological process
GO:0033037	polysaccharide localization	IEA	biological process
GO:0030326	embryonic limb morphogenesis	IEA	biological process
GO:0030204	chondroitin sulfate metabolic process	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0002063	chondrocyte development	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030206	chondroitin sulfate biosynthetic process	IDA	biological process
GO:0047756	chondroitin 4-sulfotransferase activity	IDA	molecular function
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	IDA	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00532	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R