• Gene id: 5042

Gene Summary

• Gene Symbol: PABPC3   Gene   UCSC   Ensembl
• Aliases: PABP3, PABPL3, tPABP
• Gene name: poly(A) binding protein cytoplasmic 3
• Alternate names: polyadenylate-binding protein 3, PABP-3, poly(A)-binding protein 3, poly(A)-binding protein-like 3, testis PABP, testis-specific poly(A)-binding protein (PABP), testis-specific poly(A)-binding protein 3,
• Gene location: 13q12.13 (25096137: 25098566)     Exons: 1     NC_000013.11
• Gene summary(Entrez): Messenger RNA stability and translation initiation are extensively under the control of poly(A)-binding proteins (PABP). See PABPC1 (MIM 604679) for background information.[supplied by OMIM, Jul 2002]
• OMIM: 604680

Protein Summary

• Protein general information: Q9H361  
  • Name: Polyadenylate binding protein 3 (PABP 3) (Poly(A) binding protein 3) (Testis specific poly(A) binding protein)
  • Length: 631  
  • Mass: 70,031
• Sequence:

  MNPSTPSYPTASLYVGDLHPDVTEAMLYEKFSPAGPILSIRICRDLITSGSSNYAYVNFQHTKDAEHALDTMNFD
  VIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDKSINNKALYDTVSAFGNILSCNVVCDENGSKGYGFVHFETHEA
  AERAIKKMNGMLLNGRKVFVGQFKSRKEREAELGARAKEFPNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTD
  ESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRTFEQMKQDRITRYQVVNLYVKN
  LDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQ
  AYLTNEYMQRMASVRAVPNQRAPPSGYFMTAVPQTQNHAAYYPPSQIARLRPSPRWTAQGARPHPFQNKPSAIRP
  GAPRVPFSTMRPASSQVPRVMSTQRVANTSTQTVGPRPAAAAAAAATPAVRTVPRYKYAAGVRNPQQHRNAQPQV
  TMQQLAVHVQGQETLTASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRS
  KVDEAVAVLQAHQAKEATQKAVNSATGVPTV

• Structural information:
  • Protein Domains: RRM (11-89)
    RRM (99-175)
    RRM (191-268)
    RRM (294-370)
    (-)
  • Interpro: IPR012677  IPR036053  IPR006515  IPR002004  IPR035979   IPR000504  IPR003954  
  • Prosite: PS51309 PS50102
  • PDB: 2D9P 4IVE
  • PDBsum: 2D9P 4IVE
  • STRING: ENSP00000281589
• Other Databases: GeneCards:  PABPC3  Malacards:  PABPC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	NAS	cellular component
GO:0008143	poly(A) binding	IDA	molecular function
GO:0016071	mRNA metabolic process	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	NAS	cellular component
GO:0008143	poly(A) binding	IDA	molecular function
GO:0016071	mRNA metabolic process	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005737	cytoplasm	NAS	cellular component
GO:0008143	poly(A) binding	IDA	molecular function
GO:0016071	mRNA metabolic process	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 26843391
Male factor infertility	MIK: 26843391
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 26843391
Non-obstructive azoospermia	MIK: 26843391
RS arrest	MIK: 26843391
SC arrest	MIK: 26843391
Sertoli cell-only syndrome (SCO)	MIK: 26843391
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26843391	NOA including hypospermatogenesis (hyposperm), RS arrest, SC arrest, and Sertoli cell-only syndrome (SCO), Male infertility				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray