• Gene id: 5030

Gene Summary

• Gene Symbol: P2RY4   Gene   UCSC   Ensembl
• Aliases: NRU, P2P, P2Y4, UNR
• Gene name: pyrimidinergic receptor P2Y4
• Alternate names: P2Y purinoceptor 4, pyrimidinergic receptor P2Y, G-protein coupled, 4, uridine nucleotide receptor,
• Gene location: Xq13.1 (70259803: 70258165)     Exons: 1     NC_000023.11
• Gene summary(Entrez): The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor
• OMIM: 300038

Protein Summary

• Protein general information: P51582  
  • Name: P2Y purinoceptor 4 (P2Y4) (P2P) (Uridine nucleotide receptor) (UNR)
  • Length: 365  
  • Mass: 40963
  • Tissue specificity: Pancreas.
• Sequence:

  MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLFIFRLRPWDATATYMF
  HLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLYCSVLFLTCISVHRYLGICHPLRALRWGRPR
  LAGLLCLAVWLVVAGCLVPNLFFVTTSNKGTTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMAR
  RLYQPLPGSAQSSSRLRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC
  LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTPRADRL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000018  
  • Prosite: PS00237 PS50262
  • PDB: 2B6Q
  • PDBsum: 2B6Q
  • STRING: ENSP00000363643
• Other Databases: GeneCards:  P2RY4  Malacards:  P2RY4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071318	cellular response to ATP	TAS	biological process
GO:0030321	transepithelial chloride transport	IEA	biological process
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0030321	transepithelial chloride transport	IEA	biological process
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0045030	G protein-coupled UTP receptor activity	IEA	molecular function
GO:0099509	regulation of presynaptic cytosolic calcium ion concentration	IEA	biological process
GO:0099059	integral component of presynaptic active zone membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045030	G protein-coupled UTP receptor activity	TAS	molecular function
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04742	Taste transduction

Diseases

Associated diseases	References
Obstructive azoospermia	MIK: 30389958

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
30389958	Obstructive azoospermia	c.59G?>?A (p.Ser20Asn)		4 (2 infertile brothers and 2 fertile family members)	Male infertility	NGS