• Gene id: 5003

Gene Summary

• Gene Symbol: SLC22A18AS   Gene   UCSC   Ensembl
• Aliases: BWR1B, BWSCR1B, ORCTL2S, SLC22A1LS, p27-BWR1B
• Gene name: solute carrier family 22 member 18 antisense
• Alternate names: beckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, Beckwith-Wiedemann region 1B, Beckwith-Wiedemann syndrome chromosome region 1, candidate b, organic cation transporter-like 2 antisense, organic cation transporter-like protein 2 antis,
• Gene location: 11p15.4 (2905503: 2887343)     Exons: 6     NC_000011.10
• OMIM: 610931

Protein Summary

• Protein general information: Q8N1D0  
  • Name: Beckwith Wiedemann syndrome chromosomal region 1 candidate gene B protein (Organic cation transporter like protein 2 antisense protein) (Solute carrier family 22 member 1 like antisense protein) (Solute carrier family 22 member 18 antisense protein) (p27
  • Length: 253  
  • Mass: 27061
  • Tissue specificity: Most abundantly expressed in gastrointestinal tissues. Expressed at lower levels in kidney and placenta. Expressed in fetal brain, liver, placenta, kidney and lung. {ECO
• Sequence:

  MGELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGG
  RKGFGSSGLRFGRGGFSEEVMPQPVLKAMRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGRDRLEVVYSVP
  DNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPELTTPDSGLPRPPNPA
  LAGFRALAQHSPPLGTSTPSAVLLSAAT

• Structural information:
  • STRING: ENSP00000433282
• Other Databases: GeneCards:  SLC22A18AS  Malacards:  SLC22A18AS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq