• Gene id: 4946

Gene Summary

• Gene Symbol: OAZ1   Gene   UCSC   Ensembl
• Aliases: AZ1, AZI, OAZ
• Gene name: ornithine decarboxylase antizyme 1
• Alternate names: ornithine decarboxylase antizyme 1, ODC-Az, antizyme 1,
• Gene location: 19p13.3 (2269485: 2273487)     Exons: 5     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which i
• OMIM: 601579

Protein Summary

• Protein general information: P54368  
  • Name: Ornithine decarboxylase antizyme 1 (AZ1) (ODC Az)
  • Length: 228  
  • Mass: 25406
• Sequence:

  MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNPGPGPRWCSDAPHPPL
  KIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLYIEIPGGALPE
  GSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESSGE
  EEE

• Structural information:
  • Interpro: IPR016181  IPR029914  IPR002993  IPR038581  
  • Prosite: PS01337
  • PDB: 4ZGY 4ZGZ 5BWA
  • PDBsum: 4ZGY 4ZGZ 5BWA
  • STRING: ENSP00000473381
• Other Databases: GeneCards:  OAZ1  Malacards:  OAZ1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008073	ornithine decarboxylase inhibitor activity	IBA	molecular function
GO:0045732	positive regulation of protein catabolic process	IBA	biological process
GO:0045732	positive regulation of protein catabolic process	IDA	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	IDA	molecular function
GO:0090316	positive regulation of intracellular protein transport	ISS	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	ISS	molecular function
GO:0045732	positive regulation of protein catabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0006595	polyamine metabolic process	IEA	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	IEA	molecular function
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	TAS	molecular function
GO:0006596	polyamine biosynthetic process	TAS	biological process
GO:0006521	regulation of cellular amino acid metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0090316	positive regulation of intracellular protein transport	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	IEA	molecular function
GO:1902268	negative regulation of polyamine transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)