• Gene id: 4938

Gene Summary

• Gene Symbol: OAS1   Gene   UCSC   Ensembl
• Aliases: E18/E16, IFI-4, OIAS, OIASI
• Gene name: 2'-5'-oligoadenylate synthetase 1
• Alternate names: 2'-5'-oligoadenylate synthase 1, (2-5')oligo(A) synthase 1, 2',5'-oligo A synthetase 1, 2'-5'-oligoadenylate synthetase 1, 40/46kDa, 2'-5'-oligoisoadenylate synthetase 1, 2-5A synthase 1, 2-5A synthetase 1, E16 (2'-5') oligo A synthetase,
• Gene location: 12q24.13 (112906776: 112933218)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene is induced by interferons and encodes a protein that synthesizes 2',5'-oligoadenylates (2-5As). This protein activates latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Alternative splicing results i
• OMIM: 164350

Protein Summary

• Protein general information: P00973  
  • Name: 2' 5' oligoadenylate synthase 1 ((2 5')oligo(A) synthase 1) (2 5A synthase 1) (EC 2.7.7.84) (E18/E16) (p46/p42 OAS)
  • Length: 400  
  • Mass: 46029
• Sequence:

  MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSD
  ADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVL
  PAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGK
  LPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
  PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPH
  FSHRPSTLQAASTPQAEEDWTCTIL

• Structural information:
  • Interpro: IPR006117  IPR006116  IPR018952  IPR038121  IPR026774   IPR002934  
  • Prosite: PS00832 PS00833 PS50152
  • PDB: 4IG8
  • PDBsum: 4IG8
  • STRING: ENSP00000388001
• Other Databases: GeneCards:  OAS1  Malacards:  OAS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0045071	negative regulation of viral genome replication	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0001730	2'-5'-oligoadenylate synthetase activity	IBA	molecular function
GO:0003725	double-stranded RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0060700	regulation of ribonuclease activity	IBA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0001730	2'-5'-oligoadenylate synthetase activity	IDA	molecular function
GO:0005524	ATP binding	TAS	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0001730	2'-5'-oligoadenylate synthetase activity	IEA	molecular function
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0051607	defense response to virus	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0001730	2'-5'-oligoadenylate synthetase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051607	defense response to virus	TAS	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	colocalizes with
GO:0042593	glucose homeostasis	IMP	biological process
GO:0006006	glucose metabolic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa04621	NOD-like receptor signaling pathway
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa05162	Measles

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R