• Gene id: 4849

Gene Summary

• Gene Symbol: CNOT3   Gene   UCSC   Ensembl
• Aliases: IDDSADF, LENG2, NOT3, NOT3H
• Gene name: CCR4-NOT transcription complex subunit 3
• Alternate names: CCR4-NOT transcription complex subunit 3, CCR4-associated factor 3, NOT3 (negative regulator of transcription 3, yeast) homolog, leukocyte receptor cluster member 2,
• Gene location: 19q13.42 (54137688: 54155689)     Exons: 20     NC_000019.10

Protein Summary

• Protein general information: O75175  
  • Name: CCR4 NOT transcription complex subunit 3 (CCR4 associated factor 3) (Leukocyte receptor cluster member 2)
  • Length: 753  
  • Mass: 81872
  • Tissue specificity: Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. {ECO
• Sequence:

  MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKR
  QLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLS
  VQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFL
  YDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSP
  AKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAV
  APPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNA
  SSQALGPPSGPHNPPPSTSKEPSAAAPTGAGGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGP
  PQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVC
  PLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIF
  YYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDR
  DLQ

• Structural information:
  • Interpro: IPR038635  IPR012270  IPR040168  IPR007282  IPR007207  
  • PDB: 4C0D 4C0G 5FU6 5FU7
  • PDBsum: 4C0D 4C0G 5FU6 5FU7
  • DIP: 40297
  • STRING: ENSP00000351159
• Other Databases: GeneCards:  CNOT3  Malacards:  CNOT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IBA	biological process
GO:2000036	regulation of stem cell population maintenance	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0004535	poly(A)-specific ribonuclease activity	IBA	molecular function
GO:0017148	negative regulation of translation	IBA	biological process
GO:0030015	CCR4-NOT core complex	IBA	cellular component
GO:0030014	CCR4-NOT complex	IDA	cellular component
GO:0000932	P-body	ISS	cellular component
GO:2000036	regulation of stem cell population maintenance	IMP	biological process
GO:0030015	CCR4-NOT core complex	IEA	cellular component
GO:0042025	host cell nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000932	P-body	IEA	cellular component
GO:2000036	regulation of stem cell population maintenance	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0001829	trophectodermal cell differentiation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq