• Gene id: 4826

Gene Summary

• Gene Symbol: NNAT   Gene   UCSC   Ensembl
• Aliases: Peg5
• Gene name: neuronatin
• Alternate names: neuronatin,
• Gene location: 20q11.23 (37521249: 37523689)     Exons: 3     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found
• OMIM: 603106

Protein Summary

• Protein general information: Q16517  
  • Name: Neuronatin
  • Length: 81  
  • Mass: 9237
• Sequence:

  MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGER
  RQRAPN

• Structural information:
  • Interpro: IPR024885  
  • STRING: ENSP00000062104
• Other Databases: GeneCards:  NNAT  Malacards:  NNAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0007420	brain development	IBA	biological process
GO:0032024	positive regulation of insulin secretion	IBA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007420	brain development	TAS	biological process
GO:0009249	protein lipoylation	TAS	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0007420	brain development	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881