• Gene id: 474344

Gene Summary

• Gene Symbol: GIMAP6   Gene   UCSC   Ensembl
• Aliases: IAN-2, IAN-6, IAN2, IAN6
• Gene name: GTPase, IMAP family member 6
• Alternate names: GTPase IMAP family member 6, immune associated nucleotide 2, immune associated nucleotide 6, immune-associated nucleotide-binding protein 6,
• Gene location: 7q36.1 (150632647: 150625374)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the GTPases of immunity-associated proteins (GIMAP) family. GIMAP proteins contain GTP-binding and coiled-coil motifs, and may play roles in the regulation of cell survival. Decreased expression of this gene may play a role i
• OMIM: 616960

Protein Summary

• Protein general information: Q6P9H5  
  • Name: GTPase IMAP family member 6 (Immunity associated nucleotide 2 protein) (IAN 2) (hIAN2) (Immunity associated nucleotide 6 protein) (IAN 6) (hIAN6)
  • Length: 292  
  • Mass: 32949
  • Tissue specificity: Highly expressed in spleen, lymph nodes, lung and placenta. Expressed at moderate level in thymus, kidney, heart and digestive tract. Weakly expressed in other lymphoid tissues. Detected in T-cells. {ECO
• Sequence:

  MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPV
  TKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVF
  GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWE
  NEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL

• Structural information:
  • Protein Domains: (38..24-)
    (/note="AIG1-type-G")
  • Interpro: IPR006703  IPR027417  
  • Prosite: PS51720
  • STRING: ENSP00000479580
• Other Databases: GeneCards:  GIMAP6  Malacards:  GIMAP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)