• Gene id: 4682

Gene Summary

• Gene Symbol: NUBP1   Gene   UCSC   Ensembl
• Aliases: CIAO5, NBP, NBP1, NBP35
• Gene name: nucleotide binding protein 1
• Alternate names: cytosolic Fe-S cluster assembly factor NUBP1, NBP 1, nucleotide binding protein (e.coli MinD like), nucleotide binding protein 1 (E.coli MinD like), nucleotide binding protein 1 (MinD homolog, E. coli),
• Gene location: 16p13.13 (10743163: 10769350)     Exons: 11     NC_000016.10
• Gene summary(Entrez): NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).[supplied by OMIM, Mar 2008]
• OMIM: 600280

Protein Summary

• Protein general information: P53384  
  • Name: Cytosolic Fe S cluster assembly factor NUBP1 (Nucleotide binding protein 1) (NBP 1)
  • Length: 320  
  • Mass: 34534
• Sequence:

  MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHL
  AHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKN
  GMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIG
  VVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSII
  QRIQEFCNLHQSKEENLISS

• Structural information:
  • Interpro: IPR003593  IPR019591  IPR000808  IPR028601  IPR027417   IPR033756  
  • Prosite: PS01215
  • STRING: ENSP00000283027
• Other Databases: GeneCards:  NUBP1  Malacards:  NUBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051536	iron-sulfur cluster binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0016226	iron-sulfur cluster assembly	IBA	biological process
GO:0051536	iron-sulfur cluster binding	IDA	molecular function
GO:0016226	iron-sulfur cluster assembly	IMP	biological process
GO:0001558	regulation of cell growth	IMP	biological process
GO:0006879	cellular iron ion homeostasis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016226	iron-sulfur cluster assembly	IEA	biological process
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0030030	cell projection organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005929	cilium	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	TAS	molecular function
GO:0072697	protein localization to cell cortex	IEA	biological process
GO:0051642	centrosome localization	IEA	biological process
GO:0010826	negative regulation of centrosome duplication	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0016226	iron-sulfur cluster assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881