• Gene id: 4599

Gene Summary

• Gene Symbol: MX1   Gene   UCSC   Ensembl
• Aliases: IFI-78K, IFI78, MX, MxA, lncMX1-215
• Gene name: MX dynamin like GTPase 1
• Alternate names: interferon-induced GTP-binding protein Mx1, interferon-induced protein p78, interferon-inducible protein p78, interferon-regulated resistance GTP-binding protein MxA, myxoma resistance protein 1, myxovirus (influenza virus) resistance 1, interferon-inducible p,
• Gene location: 21q22.3 (41420328: 41459213)     Exons: 24     NC_000021.9
• Gene summary(Entrez): This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type I and type II interferons and antagonizes the replication process of several different RNA a
• OMIM: 147150

Protein Summary

• Protein general information: P20591  
  • Name: Interferon induced GTP binding protein Mx1 (Interferon induced protein p78) (IFI 78K) (Interferon regulated resistance GTP binding protein MxA) (Myxoma resistance protein 1) (Myxovirus resistance protein 1) [Cleaved into: Interferon induced GTP binding pr
  • Length: 662  
  • Mass: 75520
• Sequence:

  MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAV
  IGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAI
  AGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIAT
  TEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
  IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKYGVDIPEDENEKMFFL
  IDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENQYRGRELPGFVN
  YRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHF
  QMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
  QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG

• Structural information:
  • Protein Domains: (67..34-)
    (/note="Dynamin-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01055-)
    (574..66-)
    (/note="GED-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00720"-)
  • Interpro: IPR000375  IPR001401  IPR019762  IPR022812  IPR030381   IPR003130  IPR020850  IPR027417  
  • Prosite: PS00410 PS51718 PS51388
  • CDD: cd08771
  • PDB: 3LJB 3SZR 3ZYS 4P4S 4P4T 4P4U 5GTM
  • PDBsum: 3LJB 3SZR 3ZYS 4P4S 4P4T 4P4U 5GTM
  • DIP: 35694
  • STRING: ENSP00000381601
• Other Databases: GeneCards:  MX1  Malacards:  MX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000266	mitochondrial fission	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0008017	microtubule binding	IBA	molecular function
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0016185	synaptic vesicle budding from presynaptic endocytic zone membrane	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0050803	regulation of synapse structure or activity	IBA	biological process
GO:0061025	membrane fusion	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0031623	receptor internalization	IBA	biological process
GO:0031966	mitochondrial membrane	IBA	cellular component
GO:0043197	dendritic spine	IBA	cellular component
GO:0044327	dendritic spine head	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0048285	organelle fission	IBA	biological process
GO:0098844	postsynaptic endocytic zone membrane	IBA	cellular component
GO:0098884	postsynaptic neurotransmitter receptor internalization	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0034340	response to type I interferon	TAS	biological process
GO:0009615	response to virus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005525	GTP binding	TAS	molecular function
GO:0006915	apoptotic process	TAS	biological process
GO:0006952	defense response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0051607	defense response to virus	IDA	biological process
GO:0005829	cytosol	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa05162	Measles

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq