• Gene id: 4430

Gene Summary

• Gene Symbol: MYO1B   Gene   UCSC   Ensembl
• Aliases: MMI-alpha, MMIa, MYH-1c, myr1
• Gene name: myosin IB
• Alternate names: unconventional myosin-Ib, MYO1B variant protein, myosin-I alpha,
• Gene location: 2q32.3 (191245399: 191425385)     Exons: 34     NC_000002.12
• OMIM: 606537

Protein Summary

• Protein general information: O43795  
  • Name: Unconventional myosin Ib (MYH 1c) (Myosin I alpha) (MMI alpha) (MMIa)
  • Length: 1136  
  • Mass: 131985
• Sequence:

  MAKMEVKTSLLDNMIGVGDMVLLEPLNEETFINNLKKRFDHSEIYTYIGSVVISVNPYRSLPIYSPEKVEEYRNR
  NFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGAEVNQVKEQLLQSNPVLE
  AFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLNKLKL
  ERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKI
  KDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVNRINESIKAQ
  TKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLKEEQEEYIREDIEWTHIDYFNNAIICDLIE
  NNTNGILAMLDEECLRPGTVTDETFLEKLNQVCATHQHFESRMSKCSRFLNDTSLPHSCFRIQHYAGKVLYQVEG
  FVDKNNDLLYRDLSQAMWKASHALIKSLFPEGNPAKINLKRPPTAGSQFKASVATLMKNLQTKNPNYIRCIKPND
  KKAAHIFNEALVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPV
  EEYSFGRSKIFIRNPRTLFKLEDLRKQRLEDLATLIQKIYRGWKCRTHFLLMKKSQIVIAAWYRRYAQQKRYQQT
  KSSALVIQSYIRGWKARKILRELKHQKRCKEAVTTIAAYWHGTQARRELRRLKEEARNKHAIAVIWAYWLGSKAR
  RELKRLKEEARRKHAVAVIWAYWLGLKVRREYRKFFRANAGKKIYEFTLQRIVQKYFLEMKNKMPSLSPIDKNWP
  SRPYLFLDSTHKELKRIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSVGQPFQGAYLEINKNPK
  YKKLKDAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVH
  LKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKR
  KNNRLLEVAVP

• Structural information:
  • Protein Domains: (15..70-)
    (/note="Myosin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00782-)
    (704..73-)
    (/note="IQ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00116-)
    (728..74-)
    (/note="IQ-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00116";-)
  • Interpro: IPR000048  IPR036961  IPR001609  IPR010926  IPR036072   IPR027417  
  • Prosite: PS50096 PS51456 PS51757
  • CDD: cd01378
  • STRING: ENSP00000376132
• Other Databases: GeneCards:  MYO1B  Malacards:  MYO1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005903	brush border	IBA	cellular component
GO:0030898	actin-dependent ATPase activity	IBA	molecular function
GO:0031982	vesicle	IBA	cellular component
GO:0000146	microfilament motor activity	IBA	molecular function
GO:0005902	microvillus	IBA	cellular component
GO:0007015	actin filament organization	IBA	biological process
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0030050	vesicle transport along actin filament	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0003774	motor activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0030898	actin-dependent ATPase activity	IEA	molecular function
GO:0051017	actin filament bundle assembly	IEA	biological process
GO:0000146	microfilament motor activity	IEA	molecular function
GO:0030048	actin filament-based movement	IEA	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0045177	apical part of cell	IEA	cellular component
GO:0051015	actin filament binding	IEA	molecular function
GO:0071944	cell periphery	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0032588	trans-Golgi network membrane	IDA	colocalizes with
GO:0005884	actin filament	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0005524	ATP binding	IMP	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	ISS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051015	actin filament binding	IMP	molecular function
GO:0007015	actin filament organization	IMP	biological process
GO:0071944	cell periphery	ISS	cellular component
GO:0030175	filopodium	ISS	cellular component
GO:0006892	post-Golgi vesicle-mediated transport	IMP	biological process
GO:0051017	actin filament bundle assembly	ISS	biological process
GO:0005903	brush border	ISS	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	ISS	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0000146	microfilament motor activity	IMP	molecular function
GO:0030048	actin filament-based movement	ISS	biological process
GO:0000146	microfilament motor activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray