• Gene id: 441631

Gene Summary

• Gene Symbol: TSPAN11   Gene   UCSC   Ensembl
• Aliases: VSSW1971
• Gene name: tetraspanin 11
• Alternate names: tetraspanin-11, tspan-11,
• Gene location: 12p11.21 (30926432: 31016501)     Exons: 15     NC_000012.12
• OMIM: 615138

Protein Summary

• Protein general information: A1L157  
  • Name: Tetraspanin 11 (Tspan 11)
  • Length: 253  
  • Mass: 28245
• Sequence:

  MAHYKTEQDDWLIIYLKYLLFVFNFFFWVGGAAVLAVGIWTLVEKSGYLSVLASSTFAASAYILIFAGVLVMVTG
  FLGFGAILWERKGCLSTYFCLLLVIFLVELVAGVLAHVYYQRLSDELKQHLNRTLAENYGQPGATQITASVDRLQ
  QDFKCCGSNSSADWQHSTYILLREAEGRQVPDSCCKTVVVRCGQRAHPSNIYKVEGGCLTKLEQFLADHLLLMGA
  VGIGVACLQICGMVLTCCLHQRLQRHFY

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR008952  
  • STRING: ENSP00000261177
• Other Databases: GeneCards:  TSPAN11  Malacards:  TSPAN11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016477	cell migration	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq