• Gene id: 441549

Gene Summary

• Gene Symbol: CDNF   Gene   UCSC   Ensembl
• Aliases: ARMETL1
• Gene name: cerebral dopamine neurotrophic factor
• Alternate names: cerebral dopamine neurotrophic factor, ARMET-like protein 1, arginine-rich, mutated in early stage tumors-like 1, conserved dopamine neurotrophic factor,
• Gene location: 10p13 (14838072: 14819244)     Exons: 4     NC_000010.11
• OMIM: 0

Protein Summary

• Protein general information: Q49AH0  
  • Name: Cerebral dopamine neurotrophic factor (ARMET like protein 1) (Conserved dopamine neurotrophic factor)
  • Length: 187  
  • Mass: 20964
  • Tissue specificity: Widely expressed in neuronal and non-neuronal tissues. In the brain, highest levels in the optic nerve and corpus callosum. {ECO
• Sequence:

  MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTK
  GKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQI
  LHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

• Structural information:
  • Interpro: IPR019345  IPR036361  
  • PDB: 2LPN 2W50 4BIT
  • PDBsum: 2LPN 2W50 4BIT
  • STRING: ENSP00000419395
• Other Databases: GeneCards:  CDNF  Malacards:  CDNF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071542	dopaminergic neuron differentiation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0031175	neuron projection development	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)