• Gene id: 440533

Gene Summary

• Gene Symbol: PSG8   Gene   UCSC   Ensembl
• Aliases: PSG1
• Gene name: pregnancy specific beta-1-glycoprotein 8
• Alternate names: pregnancy-specific beta-1-glycoprotein 8, C1 alternate, C2 alternate, C3 alternate, PS-beta-G-8, PSBG-8, pregnancy-specific beta-1 glycoprotein, pregnancy-specific glycoprotein 8,
• Gene location: 19q13.2 (42765691: 42752685)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunog
• OMIM: 603232

Protein Summary

• Protein general information: Q9UQ74  
  • Name: Pregnancy specific beta 1 glycoprotein 8 (PS beta G 8) (PSBG 8) (Pregnancy specific glycoprotein 8)
  • Length: 426  
  • Mass: 47772
• Sequence:

  MGLLSAPPCTQRITWKGLLLTASLLNFWNPPTTAQVTIEAQPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDL
  YHYITSYVVDGQIIIYGPAYSGRETIYSNASLLIQNVTQEDAGSYTLHIIMGGDENRGVTGHFTFTLYLETPKPS
  ISSSKLNPREAMEAVSLTCDPETPDASYLWWMNGQSLPMSHRLQLSETNRTLFLLGVTKYTAGPYECEIRNPVSA
  SRSDPFTLNLLPKLPKPYITINNLKPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSV
  TRNETGPYQCEIRDQYGGIRSYPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINGKFQLS
  GQKLFIPQITTKHSGLYACSVRNSATGKESSKSMTVKVSGKRIPVSLAIGI

• Structural information:
  • Protein Domains: (35..14-)
    (/note="Ig-like-V-type)
    (147..23-)
    1 (/note="Ig-like-C2-type)
    (240..32-)
    2 (/note="Ig-like-C2-type)
    (335..41-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000305005
• Other Databases: GeneCards:  PSG8  Malacards:  PSG8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq