• Gene id: 4356

Gene Summary

• Gene Symbol: MPP3   Gene   UCSC   Ensembl
• Aliases: DLG3
• Gene name: membrane palmitoylated protein 3
• Alternate names: MAGUK p55 subfamily member 3, discs, large homolog 3, membrane protein palmitoylated 3, membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3),
• Gene location: 17q21.31 (43833193: 43800798)     Exons: 22     NC_000017.11
• Gene summary(Entrez): This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions
• OMIM: 606455

Protein Summary

• Protein general information: Q13368  
  • Name: MAGUK p55 subfamily member 3 (Discs large homolog 3) (Protein MPP3)
  • Length: 585  
  • Mass: 66152
• Sequence:

  MPVLSEDSGLHETLALLTSQLRPDSNHKEEMGFLRDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDV
  MEELQAASVHSDERELLQLLSTPHLRAVLMVHDTVAQKNFDPVLPPLPDNIDEDFDEESVKIVRLVKNKEPLGAT
  IRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEEDRLK
  ESKVFMRALFHYNPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKGFQERRLSYRR
  AAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGLRRSFRLGCRERLGGSQEGKMSSGAESPELLTYEEVA
  RYQHQPGERPRLVVLIGSLGARLHELKQKVVAENPQHFGVAVPHTTRPRKSHEKEGVEYHFVSKQAFEADLHHNK
  FLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMSPACEDTAA
  PFDEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQGAYSQLKVVLEKLSKDTHWVPVSWVR

• Structural information:
  • Protein Domains: (6..6-)
    (/note="L27-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00365-)
    (61..11-)
    (/note="L27-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00365-)
    (137..21-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (22-)
  • Interpro: IPR008145  IPR008144  IPR020590  IPR014775  IPR004172   IPR036892  IPR035604  IPR027417  IPR001478  IPR036034  IPR036028  IPR001452  
  • Prosite: PS00856 PS50052 PS51022 PS50106 PS50002
  • CDD: cd12039
  • STRING: ENSP00000381425
• Other Databases: GeneCards:  MPP3  Malacards:  MPP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881