• Gene id: 4355

Gene Summary

• Gene Symbol: MPP2   Gene   UCSC   Ensembl
• Aliases: DLG2
• Gene name: membrane palmitoylated protein 2
• Alternate names: MAGUK p55 subfamily member 2, discs large, homolog 2, membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2),
• Gene location: 17q21.31 (43909710: 43875356)     Exons: 21     NC_000017.11
• Gene summary(Entrez): Palmitoylated membrane protein 2 is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intrac
• OMIM: 600723

Protein Summary

• Protein general information: Q14168  
  • Name: MAGUK p55 subfamily member 2 (Discs large homolog 2) (Protein MPP2)
  • Length: 576  
  • Mass: 64581
• Sequence:

  MPVAATNSETAMQQVLDNLGSLPSATGAAELDLIFLRGIMESPIVRSLAKVIMVLWFMQQNVFVPMKYMLKYFGA
  HERLEETKLEAVRDNNLELVQEILRDLAHVAEQSSTAAELAHILQEPHFQSLLETHDSVASKTYETPPPSPGLDP
  TFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELVIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQ
  ELLRNASGSVILKILPSYQEPHLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVE
  GGSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYEEVARMPPFRRK
  TLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEMEADVRAGRYLEHGEYEGNL
  YGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRRT
  VEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY

• Structural information:
  • Protein Domains: (8..6-)
    (/note="L27-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00365-)
    (84..14-)
    (/note="L27-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00365-)
    (185..24-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (24-)
  • Interpro: IPR008145  IPR008144  IPR020590  IPR014775  IPR004172   IPR036892  IPR035602  IPR027417  IPR001478  IPR036034  IPR036028  IPR001452  
  • Prosite: PS00856 PS50052 PS51022 PS50106 PS50002
  • CDD: cd12037
  • PDB: 2E7K
  • PDBsum: 2E7K
  • STRING: ENSP00000428182
• Other Databases: GeneCards:  MPP2  Malacards:  MPP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005856	cytoskeleton	IDA	cellular component
GO:0060291	long-term synaptic potentiation	ISS	biological process
GO:0060079	excitatory postsynaptic potential	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0051260	protein homooligomerization	ISS	biological process
GO:0043198	dendritic shaft	ISS	cellular component
GO:0043197	dendritic spine	ISS	cellular component
GO:0032590	dendrite membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)