• Gene id: 4215

Gene Summary

• Gene Symbol: MAP3K3   Gene   UCSC   Ensembl
• Aliases: MAPKKK3, MEKK3
• Gene name: mitogen-activated protein kinase kinase kinase 3
• Alternate names: mitogen-activated protein kinase kinase kinase 3, MAP/ERK kinase kinase 3, MAPK/ERK kinase kinase 3, MEK kinase 3, MEKK 3,
• Gene location: 17q23.3 (63622208: 63696304)     Exons: 6     NC_000017.11
• Gene summary(Entrez): This gene product is a 626-amino acid polypeptide that is 96.5% identical to mouse Mekk3. Its catalytic domain is closely related to those of several other kinases, including mouse Mekk2, tobacco NPK, and yeast Ste11. Northern blot analysis revealed a 4.6
• OMIM: 602539

Protein Summary

• Protein general information: Q99759  
  • Name: Mitogen activated protein kinase kinase kinase 3 (EC 2.7.11.25) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3)
  • Length: 626  
  • Mass: 70898
• Sequence:

  MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTT
  VFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAGD
  INTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLS
  GSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRR
  HQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGR
  VYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGS
  VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMR
  SVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
  RRIFVEARQRPSAEELLTHHFAQLMY

• Structural information:
  • Protein Domains: (44..12-)
    (/note="PB1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01081-)
    (362..62-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000270  IPR034879  IPR000719  
  • Prosite: PS51745 PS50011
  • CDD: cd06405
  • PDB: 2C60 2JRH 2O2V 2PPH 4Y5O 4YL6
  • PDBsum: 2C60 2JRH 2O2V 2PPH 4Y5O 4YL6
  • DIP: 27521
  • STRING: ENSP00000354927
• Other Databases: GeneCards:  MAP3K3  Malacards:  MAP3K3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004709	MAP kinase kinase kinase activity	TAS	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular function
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001568	blood vessel development	IEA	biological process
GO:1900745	positive regulation of p38MAPK cascade	IEA	biological process
GO:0071864	positive regulation of cell proliferation in bone marrow	IMP	biological process
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	IGI	biological process
GO:2000773	negative regulation of cellular senescence	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa04722	Neurotrophin signaling pathway
hsa04912	GnRH signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq