• Gene id: 420

Gene Summary

• Gene Symbol: ART4   Gene   UCSC   Ensembl
• Aliases: ARTC4, CD297, DO, DO/ART4, DOK1
• Gene name: ADP-ribosyltransferase 4 (Dombrock blood group)
• Alternate names: ecto-ADP-ribosyltransferase 4, ADP-ribosyltransferase 4 (DO blood group), ADP-ribosyltransferase C2 and C3 toxin-like 4, Do glycoprotein, Dombrock blood group carrier molecule, Dombrock glycoprotein, NAD(+)--protein-arginine ADP-ribosyltransferase 4, NAD(P)(+)--,
• Gene location: 12p12.3 (37807789: 37809453)     Exons: 3     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that contains a mono-ADP-ribosylation (ART) motif. It is a member of the ADP-ribosyltransferase gene family but enzymatic activity has not been demonstrated experimentally. Antigens of the Dombrock blood group system are locate
• OMIM: 110600

Protein Summary

• Protein general information: Q93070  
  • Name: Ecto ADP ribosyltransferase 4 (EC 2.4.2.31) (ADP ribosyltransferase C2 and C3 toxin like 4) (ARTC4) (Dombrock blood group carrier molecule) (Mono(ADP ribosyl)transferase 4) (NAD(P)(+) arginine ADP ribosyltransferase 4) (CD antigen CD297)
  • Length: 314  
  • Mass: 35878
  • Tissue specificity: Expressed in spleen and T-cells.
• Sequence:

  MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTEGSEVAIKIDFDFAPGSFDDQYQGCSKQVME
  KLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAMASVARTPQQY
  ERSFHFKYLHYYLTSAIQLLRKDSIMENGTLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTL
  FTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSYHPRGNWLQLRSTGNLSTYNCQLLKASSKKCIPDPIAIASL
  SFLTSVIIFSKSRV

• Structural information:
  • Interpro: IPR000768  
  • Prosite: PS01291
  • STRING: ENSP00000228936
• Other Databases: GeneCards:  ART4  Malacards:  ART4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006471	protein ADP-ribosylation	IBA	biological process
GO:0018120	peptidyl-arginine ADP-ribosylation	IBA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IBA	molecular function
GO:0003956	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	IEA	molecular function
GO:0006471	protein ADP-ribosylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0003956	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006525	arginine metabolic process	NAS	biological process
GO:0003956	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	NAS	molecular function
GO:0016020	membrane	NAS	cellular component
GO:0006471	protein ADP-ribosylation	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)