• Gene id: 4185

Gene Summary

• Gene Symbol: ADAM11   Gene   UCSC   Ensembl
• Aliases: MDC
• Gene name: ADAM metallopeptidase domain 11
• Alternate names: disintegrin and metalloproteinase domain-containing protein 11, ADAM 11, metalloproteinase-like, disintegrin-like, and cysteine-rich protein,
• Gene location: 17q21.31 (146229031: 146151907)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processe
• OMIM: 155120

Protein Summary

• Protein general information: O75078  
  • Name: Disintegrin and metalloproteinase domain containing protein 11 (ADAM 11) (Metalloproteinase like, disintegrin like, and cysteine rich protein) (MDC)
  • Length: 769  
  • Mass: 83418
  • Tissue specificity: Expressed predominantly in brain. Slightly detected or not at all in other tissues.
• Sequence:

  MRLLRRWAFAALLLSLLPTPGLGTQGPAGALRWGGLPQLGGPGAPEVTEPSRLVRESSGGEVRKQQLDTRVRQEP
  PGGPPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFSREGTTQHSTGAGDHCYYQGKLRGNPHSFAALS
  TCQGLHGVFSDGNLTYIVEPQEVAGPWGAPQGPLPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKR
  QVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQ
  VQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEYGNMGAMAVTLAQTLG
  QNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNG
  FVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPP
  NLHKLDGYYCDHEQGRCYGGRCKTRDRQCQVLWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGF
  LLCVNISGAPRLGDLVGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFS
  TCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIV
  LGGTGWGFKNIRRGRSGGA

• Structural information:
  • Protein Domains: (239..43-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (444..53-)
    (/note="Disintegrin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00068-)
    (677..70-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR006586  IPR018358  IPR001762  IPR036436  IPR013032   IPR000742  IPR013111  IPR024079  IPR001590  IPR002870  IPR034027  
  • Prosite: PS50215 PS00427 PS50214 PS00022 PS50026
  • CDD: cd04269
  • STRING: ENSP00000200557
• Other Databases: GeneCards:  ADAM11  Malacards:  ADAM11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005178	integrin binding	TAS	molecular function
GO:0008237	metallopeptidase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007229	integrin-mediated signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)