• Gene id: 4139

Gene Summary

• Gene Symbol: MARK1   Gene   UCSC   Ensembl
• Aliases: MARK, Par-1c, Par1c
• Gene name: microtubule affinity regulating kinase 1
• Alternate names: serine/threonine-protein kinase MARK1, MAP/microtubule affinity-regulating kinase 1, PAR1 homolog c,
• Gene location: 1q41 (220528135: 220664460)     Exons: 22     NC_000001.11
• OMIM: 159557

Protein Summary

• Protein general information: Q9P0L2  
  • Name: Serine/threonine protein kinase MARK1 (EC 2.7.11.1) (EC 2.7.11.26) (MAP/microtubule affinity regulating kinase 1) (PAR1 homolog c) (Par 1c) (Par1c)
  • Length: 795  
  • Mass: 89003
  • Tissue specificity: Highly expressed in heart, skeletal muscle, brain, fetal brain and fetal kidney. {ECO
• Sequence:

  MSARTPLPTVNERDTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNYRLQKTIGKGNFAKVK
  LARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVA
  HGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAP
  ELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRG
  SLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRKPPEF
  EGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQRRFSDHAGPSIPPAVSYTKRPQANSVESEQK
  EEWDKDVARKLGSTTVGSKSEMTASPLVGPERKKSSTIPSNNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSL
  TEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPD
  RTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKITSKFVRRDPSEGEASGRTD
  TSRSTSGEPKERDKEEGKDSKPRSLRFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKERFLLFCVHGDARQD
  SLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL

• Structural information:
  • Protein Domains: (60..31-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (325..37-)
    (/note="UBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212-)
    (746..79-)
    (/note="KA1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00565"-)
  • Interpro: IPR028375  IPR001772  IPR011009  IPR000719  IPR017441   IPR008271  IPR015940  
  • Prosite: PS50032 PS00107 PS50011 PS00108 PS50030
  • PDB: 2HAK 3OSE 6C9D
  • PDBsum: 2HAK 3OSE 6C9D
  • DIP: 39777
  • STRING: ENSP00000483424
• Other Databases: GeneCards:  MARK1  Malacards:  MARK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0050321	tau-protein kinase activity	NAS	molecular function
GO:0010975	regulation of neuron projection development	ISS	biological process
GO:0018105	peptidyl-serine phosphorylation	NAS	biological process
GO:0050773	regulation of dendrite development	ISS	biological process
GO:0000226	microtubule cytoskeleton organization	ISS	biological process
GO:0051654	establishment of mitochondrion localization	ISS	biological process
GO:0050321	tau-protein kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0030425	dendrite	IDA	cellular component
GO:0001786	phosphatidylserine binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0070300	phosphatidic acid binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IDA	molecular function
GO:0050321	tau-protein kinase activity	IMP	molecular function
GO:0050321	tau-protein kinase activity	ISS	molecular function
GO:0001764	neuron migration	ISS	biological process
GO:0006468	protein phosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0015630	microtubule cytoskeleton	TAS	cellular component
GO:0050321	tau-protein kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005856	cytoskeleton	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0007010	cytoskeleton organization	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq