• Gene id: 4131

Gene Summary

• Gene Symbol: MAP1B   Gene   UCSC   Ensembl
• Aliases: FUTSCH, MAP5, PPP1R102
• Gene name: microtubule associated protein 1B
• Alternate names: microtubule-associated protein 1B, protein phosphatase 1, regulatory subunit 102,
• Gene location: 5q13.2 (72107474: 72209564)     Exons: 8     NC_000005.10
• Gene summary(Entrez): This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The product of this gene is a precursor poly
• OMIM: 600449

Protein Summary

• Protein general information: P46821  
  • Name: Microtubule associated protein 1B (MAP 1B) [Cleaved into: MAP1B heavy chain; MAP1 light chain LC1]
  • Length: 2468  
  • Mass: 270634
• Sequence:

  MATVVVEATEPEPSGSIANPAASTSPSLSHRFLDSKFYLLVVVGEIVTEEHLRRAIGNIELGIRSWDTNLIECNL
  DQELKLFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAVSTEVRLMITDAARHKLLVLTGQCFENTGEL
  ILQSGSFSFQNFIEIFTDQEIGELLSTTHPANKASLTLFCPEEGDWKNSNLDRHNLQDFINIKLNSASILPEMEG
  LSEFTEYLSESVEVPSPFDILEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRH
  LDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMK
  RSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTNKDKAE
  FILPNGQEVDLPISYLTSVSSLIVWHPANPAEKIIRVLFPGNSTQYNILEGLEKLKHLDFLKQPLATQKDLTGQV
  PTPVVKQTKLKQRADSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPIKTETKP
  SVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKP
  KKEEVKKEVKKEIKKEEKKEPKKEVKKETPPKEVKKEVKKEEKKEVKKEEKEPKKEIKKLPKDAKKSSTPLSEAK
  KPAALKPKVPKKEESVKKDSVAAGKPKEKGKIKVIKKEGKAAEAVAAAVGTGATTAAVMAAAGIAAIGPAKELEA
  ERSLMSSPEDLTKDFEELKAEEVDVTKDIKPQLELIEDEEKLKETEPVEAYVIQKEREVTKGPAESPDEGITTTE
  GEGECEQTPEELEPVEKQGVDDIEKFEDEGAGFEESSETGDYEEKAETEEAEEPEEDGEEHVCVSASKHSPTEDE
  ESAKAEADAYIREKRESVASGDDRAEEDMDEAIEKGEAEQSEEEADEEDKAEDAREEEYEPEKMEAEDYVMAVVD
  KAAEAGGAEEQYGFLTTPTKQLGAQSPGREPASSIHDETLPGGSESEATASDEENREDQPEEFTATSGYTQSTIE
  ISSEPTPMDEMSTPRDVMSDETNNEETESPSQEFVNITKYESSLYSQEYSKPADVTPLNGFSEGSKTDATDGKDY
  NASASTISPPSSMEEDKFSRSALRDAYCSEVKASTTLDIKDSISAVSSEKVSPSKSPSLSPSPPSPLEKTPLGER
  SVNFSLTPNEIKVSAEAEVAPVSPEVTQEVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPT
  EVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGA
  ESPFEEKSGKQGSPDQVSPVSEMTSTSLYQDKQEGKSTDFAPIKEDFGQEKKTDDVEAMSSQPALALDERKLGDV
  SPTQIDVSQFGSFKEDTKMSISEGTVSDKSATPVDEGVAEDTYSHMEGVASVSTASVATSSFPEPTTDDVSPSLH
  AEVGSPHSTEVDDSLSVSVVQTPTTFQETEMSPSKEECPRPMSISPPDFSPKTAKSRTPVQDHRSEQSSMSIEFG
  QESPEQSLAMDFSRQSPDHPTVGAGVLHITENGPTEVDYSPSDMQDSSLSHKIPPMEEPSYTQDNDLSELISVSQ
  VEASPSTSSAHTPSQIASPLQEDTLSDVAPPRDMSLYASLTSEKVQSLEGEKLSPKSDISPLTPRESSPLYSPTF
  SDSTSAVKEKTATCHSSSSPPIDAASAEPYGFRASVLFDTMQHHLALNRDLSTPGLEKDSGGKTPGDFSYAYQKP
  EETTRSPDEEDYDYESYEKTTRTSDVGGYYYEKIERTTKSPSDSGYSYETIGKTTKTPEDGDYSYEIIEKTTRTP
  EEGGYSYDISEKTTSPPEVSGYSYEKTERSRRLLDDISNGYDDSEDGGHTLGDPSYSYETTEKITSFPESEGYSY
  ETSTKTTRTPDTSTYCYETAEKITRTPQASTYSYETSDLCYTAEKKSPSEARQDVDLCLVSSCEYKHPKTELSPS
  FINPNPLEWFASEEPTEESEKPLTQSGGAPPPPGGKQQGRQCDETPPTSVSESAPSQTDSDVPPETEECPSITAD
  ANIDSEDESETIPTDKTVTYKHMDPPPAPVQDRSPSPRHPDVSMVDPEALAIEQNLGKALKKDLKEKTKTKKPGT
  KTKSSSPVKKSDGKSKPLAASPKPAGLKESSDKVSRVASPKKKESVEKAAKPTTTPEVKAARGEEKDKETKNAAN
  ASASKSAKTATAGPGTTKTTKSSAVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRVRSSYYVVSGNDPAAEEPSRA
  VLDALLEGKAQWGSNMQVTLIPTHDSEVMREWYQETHEKQQDLNIMVLASSSTVVMQDESFPACKIEL

• Structural information:
  • Interpro: IPR026074  IPR027321  IPR000102  
  • Prosite: PS00230
  • DIP: 33474
  • STRING: ENSP00000296755
• Other Databases: GeneCards:  MAP1B  Malacards:  MAP1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	TAS	molecular function
GO:0008017	microtubule binding	ISS	molecular function
GO:0030424	axon	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0036477	somatodendritic compartment	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0097441	basal dendrite	ISS	cellular component
GO:0097457	hippocampal mossy fiber	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0097440	apical dendrite	ISS	cellular component
GO:0001764	neuron migration	TAS	biological process
GO:0005874	microtubule	ISS	cellular component
GO:0048675	axon extension	TAS	biological process
GO:0043025	neuronal cell body	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0005874	microtubule	IBA	cellular component
GO:0005875	microtubule associated complex	IBA	cellular component
GO:0007409	axonogenesis	IBA	biological process
GO:0031114	regulation of microtubule depolymerization	IBA	biological process
GO:0043025	neuronal cell body	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0003779	actin binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0008017	microtubule binding	IBA	molecular function
GO:0015631	tubulin binding	IBA	molecular function
GO:0016358	dendrite development	IBA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0042995	cell projection	IBA	cellular component
GO:0009987	cellular process	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005198	structural molecule activity	NAS	molecular function
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071375	cellular response to peptide hormone stimulus	IEA	biological process
GO:0051915	induction of synaptic plasticity by chemical substance	IEA	biological process
GO:0048666	neuron development	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043204	perikaryon	IEA	cellular component
GO:0043196	varicosity	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0033189	response to vitamin A	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0014012	peripheral nervous system axon regeneration	IEA	biological process
GO:0010035	response to inorganic substance	IEA	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0007026	negative regulation of microtubule depolymerization	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005875	microtubule associated complex	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005543	phospholipid binding	IEA	molecular function
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0061162	establishment of monopolar cell polarity	IEA	biological process
GO:0047497	mitochondrion transport along microtubule	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0097457	hippocampal mossy fiber	IEA	cellular component
GO:0097441	basal dendrite	IEA	cellular component
GO:0097440	apical dendrite	IEA	cellular component
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0036477	somatodendritic compartment	IEA	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0031116	positive regulation of microtubule polymerization	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0021700	developmental maturation	IEA	biological process
GO:0017085	response to insecticide	IEA	biological process
GO:0009743	response to carbohydrate	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0048675	axon extension	IEA	biological process
GO:0032387	negative regulation of intracellular transport	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0016358	dendrite development	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray