Search Result
| Gene id | 4109 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
| Gene Symbol | MAGEA10 Gene UCSC Ensembl | ||||||||||||||||||||||||
| Aliases | CT1.10, MAGE10 | ||||||||||||||||||||||||
| Gene name | MAGE family member A10 | ||||||||||||||||||||||||
| Alternate names | melanoma-associated antigen 10, MAGE-10 antigen, cancer/testis antigen 1.10, cancer/testis antigen family 1, member 10, melanoma antigen family A, 10, melanoma antigen family A10, | ||||||||||||||||||||||||
| Gene location |
Xq28 (152138577: 152133309) Exons: 5 NC_000023.11 |
||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of thi |
||||||||||||||||||||||||
| OMIM | 300343 | ||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
| Protein general information | P43363 Name: Melanoma associated antigen 10 (Cancer/testis antigen 1.10) (CT1.10) (MAGE 10 antigen) Length: 369 Mass: 40780 Tissue specificity: Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for spermatogonia, spermatocytes and placenta. {ECO | ||||||||||||||||||||||||
| Sequence |
MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVS ADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQ MKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTG ILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP RAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE | ||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||
| Other Databases | GeneCards: MAGEA10  Malacards: MAGEA10 | ||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||