Search Result
| Gene id | 4071 | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | TM4SF1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | H-L6, L6, M3S1, TAAL6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | transmembrane 4 L six family member 1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | transmembrane 4 L6 family member 1, membrane component, chromosome 3, surface marker 1, transmembrane 4 superfamily member 1, tumor-associated antigen L6, | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
3q25.1 (149377780: 149369021) Exons: 5 NC_000003.12 |
||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate |
||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 191155 | ||||||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs587777031 Strand: Allele origin: Allele change: Mutation type: delins NC_000010.11 g.119030032_119030034CTC[1] NC_000010.11 g.119030032_119030034CTC[3] NC_000010.11 g.119030032_119030034CTC[5] NC_000010.10 g.120789544_120789546CTC[1] NC_000010.10 g.120789544_120789546CTC[3] NC_000010.10 g.120789544_120789546CTC[5] NG_0 rs79170274 Strand: Allele origin: Allele change: Mutation type: snv NC_000010.11 g.119030036T>A NC_000010.11 g.119030036T>C NC_000010.10 g.120789548T>A NC_000010.10 g.120789548T>C NG_050764.1 g.5321T>A NG_050764.1 g.5321T>C NM_199461.4 c.235T>A NM_199461.4 c.235T>C NM_199461.3 c.235T>A NM_199461.3 c.235T>C NM_199461. |
||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | P30408 Name: Transmembrane 4 L6 family member 1 (Membrane component chromosome 3 surface marker 1) (Tumor associated antigen L6) Length: 202 Mass: 21632 Tissue specificity: Highly expressed in lung, breast, colon and ovarian carcinomas. It is also present on some normal cells, endothelial cells in particular. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFFSGIVGGGLLMLLPAFVFIGLEQDDC CGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECT EPKHIVEWNVSLFSILLALGGIEFILCLIQVINGVLGGICGFCCSHQQQYDC | ||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: TM4SF1  Malacards: TM4SF1 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||