• Gene id: 4069

Gene Summary

• Gene Symbol: LYZ   Gene   UCSC   Ensembl
• Aliases: LYZF1, LZM
• Gene name: lysozyme
• Alternate names: lysozyme C, 1,4-beta-N-acetylmuramidase C, c-type lysozyme, lysozyme F1,
• Gene location: 12q15 (69348353: 69354232)     Exons: 4     NC_000012.12
• Gene summary(Entrez): This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human
• OMIM: 153450

SNPs

rs11614913

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.53991815C>T
NC_000012.11   g.54385599C>T
NR_029617.1   n.78C>T|SEQ=[C/T]|GENE=MIR196A2

Protein Summary

• Protein general information: P61626  
  • Name: Lysozyme C (EC 3.2.1.17) (1,4 beta N acetylmuramidase C)
  • Length: 148  
  • Mass: 16,537
• Sequence:

  MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIF
  QINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV

• Structural information:
  • Interpro: IPR001916  IPR019799  IPR000974  IPR023346  IPR030056  
  • Prosite: PS00128 PS51348
  • CDD: cd00119
  • PDB: 133L 134L 1B5U 1B5V 1B5W 1B5X 1B5Y 1B5Z 1B7L 1B7M 1B7N 1B7O 1B7P 1B7Q 1B7R 1B7S 1BB3 1BB4 1BB5 1C43 1C45 1C46 1C7P 1CJ6 1CJ7 1CJ8 1CJ9 1CKC 1CKD 1CKF 1CKG 1CKH 1D6P 1D6Q 1DI3 1DI4 1DI5 1EQ4 1EQ5 1EQE 1GAY 1GAZ 1GB0 1GB2 1GB3 1GB5 1GB6 1GB7 1GB8 1GB9 1GBO
  • PDBsum: 133L 134L 1B5U 1B5V 1B5W 1B5X 1B5Y 1B5Z 1B7L 1B7M 1B7N 1B7O 1B7P 1B7Q 1B7R 1B7S 1BB3 1BB4 1BB5 1C43 1C45 1C46 1C7P 1CJ6 1CJ7 1CJ8 1CJ9 1CKC 1CKD 1CKF 1CKG 1CKH 1D6P 1D6Q 1DI3 1DI4 1DI5 1EQ4 1EQ5 1EQE 1GAY 1GAZ 1GB0 1GB2 1GB3 1GB5 1GB6 1GB7 1GB8 1GB9 1GBO
  • STRING: ENSP00000261267
• Other Databases: GeneCards:  LYZ  Malacards:  LYZ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001895	retina homeostasis	IEP	biological process
GO:0003796	lysozyme activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0019835	cytolysis	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0003796	lysozyme activity	IEA	molecular function
GO:0003796	lysozyme activity	IEA	molecular function
GO:0003796	lysozyme activity	TAS	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0019835	cytolysis	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0003796	lysozyme activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Familial amyloidosis	KEGG: H00845
Male factor infertility	MIK: 10526649
Chorioamnionitis	GAD: 20673868
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 10526649
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
10526649	Male infertility				Male infertility
1724034	Male infertility			100 (60 (40 of these men suffering from sterility)	Male infertility	lysozyme
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881