• Gene id: 4045

Gene Summary

• Gene Symbol: LSAMP   Gene   UCSC   Ensembl
• Aliases: IGLON3, LAMP
• Gene name: limbic system associated membrane protein
• Alternate names: limbic system-associated membrane protein, IgLON family member 3,
• Gene location: 3q13.31 (116445486: 115802373)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the immunoglobulin LAMP, OBCAM and neurotrimin (IgLON) family of proteins. The encoded preproprotein is proteolytically processed to generate a neuronal surface glycoprotein. This protein may act as a selective homophilic adh
• OMIM: 603241

Protein Summary

• Protein general information: Q13449  
  • Name: Limbic system associated membrane protein (LSAMP) (IgLON family member 3)
  • Length: 338  
  • Mass: 37393
  • Tissue specificity: Expressed on limbic neurons and fiber tracts as well as in single layers of the superior colliculus, spinal chord and cerebellum.
• Sequence:

  MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGH
  DKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVT
  LVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESK
  SNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTN
  ASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC

• Structural information:
  • Protein Domains: (29..12-)
    1 (/note="Ig-like-C2-type)
    (132..21-)
    2 (/note="Ig-like-C2-type)
    (219..30-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  
  • Prosite: PS50835
  • STRING: ENSP00000419000
• Other Databases: GeneCards:  LSAMP  Malacards:  LSAMP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq