• Gene id: 4037

Gene Summary

• Gene Symbol: LRP3   Gene   UCSC   Ensembl
• Gene name: LDL receptor related protein 3
• Alternate names: low-density lipoprotein receptor-related protein 3, 105 kDa low-density lipoprotein receptor-related protein, CTD-2540B15.13, LRP-3, hLRp105,
• Gene location: 19q13.11 (33194329: 33208863)     Exons: 7     NC_000019.10
• OMIM: 604270

Protein Summary

• Protein general information: O75074  
  • Name: Low density lipoprotein receptor related protein 3 (LRP 3) (105 kDa low density lipoprotein receptor related protein) (hLRp105)
  • Length: 770  
  • Mass: 82884
  • Tissue specificity: Widely expressed. Highly expressed in skeletal muscle and ovary. Expressed at intermediate level in heart, brain, liver, pancreas, prostate and small intestine. Weakly expressed in testis, colon and leukocyte. {ECO
• Sequence:

  MEKRAAAGLEGAPGARAQLAVVCLVNIFLTGRLSSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWY
  IQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQ
  GFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARST
  RCLPVERRCDGLQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLEL
  RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPC
  GSSSDSDGGSLGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEK
  NCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSL
  RTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS
  RRRLGRLWNRLFHRPRAPRGQIPLLTAARPSQTVLGDGFLQPAPGAAPDPPAPLMDTGSTRAAGDRPPSAPGRAP
  EVGPSGPPLPSGLRDPECRPVDKDRKVCREPLVDGPAPADAPREPCSAQDPHPQVSTASSTLGPHSPEPLGVCRN
  PPPPCSPMLEASDDEALLVC

• Structural information:
  • Protein Domains: (43..15-)
    (/note="CUB-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (165..20-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00124-)
    (211..25-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:00002-)
  • Interpro: IPR000859  IPR036055  IPR023415  IPR002172  IPR035914  
  • Prosite: PS01180 PS01209 PS50068
  • CDD: cd00041 cd00112
  • STRING: ENSP00000253193
• Other Databases: GeneCards:  LRP3  Malacards:  LRP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0045599	negative regulation of fat cell differentiation	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq