Search Result
| Gene id | 403314 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | APOBEC4 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | C1orf169 | ||||||||||||||||||||||||||||||||||||||||
| Gene name | apolipoprotein B mRNA editing enzyme catalytic polypeptide like 4 | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | putative C->U-editing enzyme APOBEC-4, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative), | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
1q25.3 (183653315: 183646274) Exons: 2 NC_000001.11 |
||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin ge |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 609908 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8WW27 Name: Putative C >U editing enzyme APOBEC 4 (EC 3.5.4. ) (Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 4) Length: 367 Mass: 41581 Tissue specificity: Predominantly expressed in testis. {ECO | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MEPIYEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELKTSS GSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHCCISKMYNFLITYPGITL SIYFSQLYHTEMDFPASAWNREALRSLASLWPRVVLSPISGGIWHSVLHSFISGVSGSHVFQPILTGRALADRHN AYEINAITGVKPYFTDVLLQTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQLQPNLPPDLRAPVVFVLVPLRD LPPMHMGQNPNKPRNIVRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGKK | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: APOBEC4  Malacards: APOBEC4 | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||