Search Result
| Gene id | 399948 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
| Gene Symbol | COLCA1 Gene UCSC Ensembl | ||||||||||||||||||||||||
| Aliases | C11orf92, CASC12, LOH11CR1F | ||||||||||||||||||||||||
| Gene name | colorectal cancer associated 1 | ||||||||||||||||||||||||
| Alternate names | colorectal cancer-associated protein 1, cancer susceptibility candidate 12, | ||||||||||||||||||||||||
| Gene location |
11q23.1 (111305047: 111293388) Exons: 6 NC_000011.10 |
||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a transmembrane protein that localizes to granular structures, including crystalloid eosinophilic granules and other granular organelles. This gene, along with an overlapping opposite strand gene, has been implicated as a susceptibility |
||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
| Protein general information | Q6ZS62 Name: Colorectal cancer associated protein 1 Length: 124 Mass: 13401 Tissue specificity: Expressed in gastrointestinal and immune tissue, as well as prostate, testis and ovary. Expressed in lamina propria and eosinophils but not in epithelial cells. Expression is greater in benign adjacent tissues than in colon tumors. {EC | ||||||||||||||||||||||||
| Sequence |
MESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQGVCKDSKDLFVPTSS SLYGCFCVGLVSGMAISVLLLASDFRKLDFSRPEPCFEKEASLWFVAQH | ||||||||||||||||||||||||
| Structural information | |||||||||||||||||||||||||
| Other Databases | GeneCards: COLCA1  Malacards: COLCA1 | ||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||