• Gene id: 399664

Gene Summary

• Gene Symbol: MEX3D   Gene   UCSC   Ensembl
• Aliases: MEX-3D, MEX3, OK/SW-cl.4, RKHD1, RNF193, TINO
• Gene name: mex-3 RNA binding family member D
• Alternate names: RNA-binding protein MEX3D, RING finger and KH domain-containing protein 1, RING finger protein 193, bcl-2 ARE RNA binding protein, ring finger (C3HC4 type) and KH domain containing 1, ring finger and KH domain containing 1,
• Gene location: 19p13.3 (1568324: 1554668)     Exons: 4     NC_000019.10
• OMIM: 611009

Protein Summary

• Protein general information: Q86XN8  
  • Name: RNA binding protein MEX3D (RING finger and KH domain containing protein 1) (RING finger protein 193) (TINO)
  • Length: 651  
  • Mass: 64883
  • Tissue specificity: Ubiquitously expressed in all the cell lines and tissues tested. {ECO
• Sequence:

  MPSSLGQPDGGGGGGGGGGGVGAAGEDPGPGPAPPPEGAQEAAPAPRPPPEPDDAAAALRLALDQLSALGLGGAG
  DTDEEGAAGDGAAAAGGADGGAAPEPVPPDGPEAGAPPTLAPAVAPGSLPLLDPNASPPPPPPPRPSPPDVFAGF
  APHPAALGPPTLLADQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFI
  VTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGAAQGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQ
  QRTHTYIVTPGRDKEPVFAVTGMPENVDRAREEIEAHITLRTGAFTDAGPDSDFHANGTDVCLDLLGAAASLWAK
  TPNQGRRPPTATAGLRGDTALGAPSAPEAFYAGSRGGPSVPDPGPASPYSGSGNGGFAFGAEGPGAPVGTAAPDD
  CDFGFDFDFLALDLTVPAAATIWAPFERAAPLPAFSGCSTVNGAPGPPAAGARRSSGAGTPRHSPTLPEPGGLRL
  ELPLSRRGAPDPVGALSWRPPQGPVSFPGGAAFSTATSLPSSPAAAACAPLDSGASENSRKPPSASSAPALAREC
  VVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIHIFS

• Structural information:
  • Protein Domains: (179..24-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (273..33-)
    (/note="KH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117"-)
  • Interpro: IPR004087  IPR004088  IPR036612  IPR001841  IPR013083  
  • Prosite: PS50084 PS50089
  • PDB: 2DGR
  • PDBsum: 2DGR
  • STRING: ENSP00000384398
• Other Databases: GeneCards:  MEX3D  Malacards:  MEX3D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0010609	mRNA localization resulting in posttranscriptional regulation of gene expression	NAS	biological process
GO:0061157	mRNA destabilization	NAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq