Search Result
| Gene id | 3950 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | LECT2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | chm-II, chm2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | leukocyte cell derived chemotaxin 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | leukocyte cell-derived chemotaxin-2, chondromodulin-II, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
5q31.1 (179864549: 179441981) Exons: 25 NC_000002.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-indu |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 602882 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | O14960 Name: Leukocyte cell derived chemotaxin 2 (LECT 2) (hLECT2) Length: 151 Mass: 16390 Tissue specificity: Highly expressed in adult and fetal liver and weakly in testis. Not expressed in bone marrow. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIV GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAY L | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: LECT2  Malacards: LECT2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||